KEGG   Mus musculus (mouse): 13226
Entry
13226             CDS       T01002                                 

Gene name
Defa31, CRS4C-2, CRS4C2, CRS4C2b, CRS4C2c, CRS4C2d, CRS4C3a, CRS4C3a2, CRS4C3b, CRS4C3c, CRS4C3d, CRS4C3e, Defa-rs7, Defa23, Defcr-rs7, Defcr23
Definition
(RefSeq) defensin, alpha, 31
  KO
K05230  defensin, alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04621  NOD-like receptor signaling pathway
mmu05150  Staphylococcus aureus infection
mmu05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    13226 (Defa31)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    13226 (Defa31)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    13226 (Defa31)
SSDB
Motif
Pfam: Defensin_propep Defensin_1 MF_alpha_N DUF3316
Other DBs
NCBI-GeneID: 13226
NCBI-ProteinID: NP_031874
MGI: 102509
Ensembl: ENSMUSG00000074442
Vega: OTTMUSG00000019762
UniProt: Q5G866
Position
8; 8 A2
AA seq 93 aa
MKTLVLLSALILLAFQVQADPIQNTDEETKTEEQPGKEDQAVSVSFGDPEGSSLQEESLR
DLVCYCRTRGCKRRERMNGTCRKGHLIYTLCCR
NT seq 282 nt   +upstreamnt  +downstreamnt
atgaagacactagtcctcctctctgccctcatcctgctggccttccaggtccaggctgat
cctatccaaaacacagatgaagagactaaaactgaggagcagccagggaaagaggaccag
gctgtgtctgtctcttttggagacccagaaggctcttctcttcaagaggaatcgttgaga
gatctggtatgctattgtagaacaagaggctgcaaaagaagagaacgcatgaatgggacc
tgcagaaagggtcatttaatatacacgctctgctgtcgctga

DBGET integrated database retrieval system