KEGG   Mus musculus (mouse): 13236
Entry
13236             CDS       T01002                                 

Gene name
Defa25, Defcr-2, Defcr2, Defcr25
Definition
(RefSeq) defensin, alpha, 25
  KO
K05230  defensin, alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04621  NOD-like receptor signaling pathway
mmu05150  Staphylococcus aureus infection
mmu05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    13236 (Defa25)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    13236 (Defa25)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    13236 (Defa25)
SSDB
Motif
Pfam: Defensin_propep Defensin_1 MF_alpha_N
Other DBs
NCBI-GeneID: 13236
NCBI-ProteinID: NP_031875
MGI: 3630385
Ensembl: ENSMUSG00000094687
Vega: OTTMUSG00000019700
UniProt: Q5G864
Position
8 A2; 8
AA seq 92 aa
MKTLVLLSALALLAFQVQADPIQNRDEESKIDEQPGKEDQAVSVSFGDPEGSSLQEECED
LICYCRTRGCKRRERLNGTCRKGHLMYMLWCC
NT seq 279 nt   +upstreamnt  +downstreamnt
atgaagacactagtcctcctctctgcccttgccctgctggccttccaagtccaggctgat
cctatccaaaacagagatgaagagagtaaaattgatgagcagccagggaaagaagaccaa
gctgtttctgtctcctttggagacccagaaggctcttctcttcaagaggaatgtgaagat
ctgatatgctattgtagaacaagaggctgcaaaagaagagaacgcctgaatgggacctgc
agaaagggtcatttaatgtacatgctctggtgctgctga

DBGET integrated database retrieval system