KEGG   Mus musculus (house mouse): 13345
Entry
13345             CDS       T01002                                 
Symbol
Twist2, Dermo1, bHLHa39
Name
(RefSeq) twist basic helix-loop-helix transcription factor 2
  KO
K09069  twist
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    13345 (Twist2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    13345 (Twist2)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Tal/Twist/Atonal/Hen, Mesodermal Twist-like factors
    13345 (Twist2)
SSDB
Motif
Pfam: HLH HTH_51 CDK5RAP3 GDH_N
Other DBs
NCBI-GeneID: 13345
NCBI-ProteinID: NP_031881
MGI: 104685
Ensembl: ENSMUSG00000007805
UniProt: Q9D030 A5D6P6
Position
1:91729183..91775756
AA seq 160 aa
MEEGSSSPVSPVDSLGTSEEELERQPKRFGRKRRYSKKSSEDGSPTPGKRGKKGSPSAQS
FEELQSQRILANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQV
LQSDEMDNKMTSCSYVAHERLSYAFSVWRMEGAWSMSASH
NT seq 483 nt   +upstreamnt  +downstreamnt
atggaggagggctccagctcgccggtgtcccccgtggacagtctgggcaccagtgaggaa
gagctggagaggcagcccaagcgcttcggccggaagcggcgctacagcaagaaatcgagc
gaagatggcagcccgaccccgggtaagcgcggcaagaagggcagcccgagcgcgcagtct
ttcgaggagctgcagagccagcgcatcctggccaacgtgcgcgagcgccagcgcacccag
tcgctcaacgaggccttcgccgcgctgcgcaagatcatccccacgctcccctctgacaag
ctcagcaagatccagacgctcaagctggccgccaggtacatagacttcctctaccaggtt
ctccagagcgacgagatggacaataagatgaccagctgcagctacgtggctcacgagcgt
ctcagctacgccttctccgtgtggcgcatggagggcgcgtggtccatgtccgcctcccac
tag

DBGET integrated database retrieval system