KEGG   Mus musculus (mouse): 13349Help
Entry
13349             CDS       T01002                                 

Gene name
Ackr1, AA162249, CCBP1, CD234, Darc, Dfy, ESTM35, FY, GPD
Definition
(RefSeq) atypical chemokine receptor 1 (Duffy blood group)
  KO
K06574  atypical chemokine receptor 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05144  Malaria
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05144 Malaria
    13349 (Ackr1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    13349 (Ackr1)
   04050 Cytokine receptors [BR:mmu04050]
    13349 (Ackr1)
   04090 CD molecules [BR:mmu04090]
    13349 (Ackr1)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    13349 (Ackr1)
Cytokine receptors [BR:mmu04050]
 Chemokine receptors
  CC Chemokine
   13349 (Ackr1)
CD molecules [BR:mmu04090]
 Proteins
  13349 (Ackr1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GWT1
Motif
Other DBs
NCBI-GeneID: 13349
NCBI-ProteinID: NP_034175
MGI: 1097689
Ensembl: ENSMUSG00000037872
Vega: OTTMUSG00000050197
UniProt: Q9QUI6 A0A0R4J0J4
Position
1 H3; 1 80.33 cM
AA seq 334 aa AA seqDB search
MGNCLYPVENLSLDKNGTQFTFDSWNYSFEDNYSYELSSDYSLTPAAPCYSCNLLGRSSL
PFFMLTSVLGMLASGGILFAILRPFFHWQICPSWPILAELAVGSALFSIAVPILAPGLHS
AHSTALCNLGYWVWYTSAFAQALLIGCYACLNPRLNIGQLRGFTLGLSVGLWGAAALLGL
PVALASDAYNGFCAFPSSRDMEALKYMHYAICFTIFTVLPPTLLAAKGLKIALSKGPGPW
VSVLWIWFIFWWPHGMVLIFDALVRSKIVLLYTCQSQKILDAMLNVTEALSMLHCVATPL
LLALFCHQTTRRSLSSLSLPTRQASQMDALAGKS
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atggggaactgtctgtatccggtggaaaacctttcactagacaagaatggaactcagttt
actttcgacagctggaattattcgtttgaagataactactcctatgaactctcgagtgac
tacagcctgacaccagctgctccctgctactcctgtaatctgcttggcaggtcttccctt
cccttcttcatgctcaccagtgtcctgggcatgctggcaagtggcggcatcctcttcgcg
attctcagacctttcttccactggcagatttgccccagctggcccattctggcagagtta
gcagtgggcagtgccctgttcagcattgcagtgcccatcctggcaccaggcttacacagc
gcccacagcacagccctatgcaacctgggctactgggtatggtatacttctgcttttgcc
caagctctgttgataggatgctatgcttgcctgaaccccagactgaatattggtcaactc
cgtggcttcaccttgggactcagtgtgggactttggggagcagctgccctcttagggctg
ccagtcgccctggccagtgatgcttacaatggcttctgcgcctttccatcctccagagac
atggaagctttgaagtacatgcattatgccatctgttttaccatcttcactgtattgcca
ccgactcttttggcagccaaggggctgaagatagcactgagcaaggggcctggcccctgg
gttagtgtcttgtggatctggttcattttctggtggcctcatgggatggttctcatattt
gatgctttggtgaggtccaaaattgttcttctgtatacatgccaatcccagaagattctt
gatgcgatgctgaatgtgacagaagccctgagtatgctgcactgtgtggctaccccactg
ctcctggccctgttctgccatcagaccacccgtagatccttgtcctcactctccctccct
acaagacaggcttctcaaatggatgcccttgcaggcaagtcctag

DBGET integrated database retrieval system