KEGG   Mus musculus (mouse): 13350Help
Entry
13350             CDS       T01002                                 

Gene name
Dgat1, ARAT, C75990, D15Ertd23e, Dgat
Definition
(RefSeq) diacylglycerol O-acyltransferase 1
  KO
K11155  diacylglycerol O-acyltransferase 1 [EC:2.3.1.20 2.3.1.75 2.3.1.76]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00561  Glycerolipid metabolism
mmu00830  Retinol metabolism
mmu01100  Metabolic pathways
mmu04975  Fat digestion and absorption
Module
mmu_M00089  Triacylglycerol biosynthesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    13350 (Dgat1)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    13350 (Dgat1)
 09150 Organismal Systems
  09154 Digestive system
   04975 Fat digestion and absorption
    13350 (Dgat1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.20  diacylglycerol O-acyltransferase
     13350 (Dgat1)
    2.3.1.75  long-chain-alcohol O-fatty-acyltransferase
     13350 (Dgat1)
    2.3.1.76  retinol O-fatty-acyltransferase
     13350 (Dgat1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MBOAT
Motif
Other DBs
NCBI-GeneID: 13350
NCBI-ProteinID: NP_034176
MGI: 1333825
Ensembl: ENSMUSG00000022555
Vega: OTTMUSG00000034893
UniProt: Q9Z2A7 Q54AA6
Position
15 D3; 15 35.99 cM
AA seq 498 aa AA seqDB search
MGDRGGAGSSRRRRTGSRVSVQGGSGPKVEEDEVRDAAVSPDLGAGGDAPAPAPAPAHTR
DKDGRTSVGDGYWDLRCHRLQDSLFSSDSGFSNYRGILNWCVVMLILSNARLFLENLIKY
GILVDPIQVVSLFLKDPYSWPAPCVIIASNIFVVAAFQIEKRLAVGALTEQMGLLLHVVN
LATIICFPAAVALLVESITPVGSVFALASYSIMFLKLYSYRDVNLWCRQRRVKAKAVSTG
KKVSGAAAQQAVSYPDNLTYRDLYYFIFAPTLCYELNFPRSPRIRKRFLLRRVLEMLFFT
QLQVGLIQQWMVPTIQNSMKPFKDMDYSRIIERLLKLAVPNHLIWLIFFYWFFHSCLNAV
AELLQFGDREFYRDWWNAESVTYFWQNWNIPVHKWCIRHFYKPMLRHGSSKWVARTGVFL
TSAFFHEYLVSVPLRMFRLWAFTAMMAQVPLAWIVGRFFQGNYGNAAVWVTLIIGQPVAV
LMYVHDYYVLNYDAPVGV
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgggcgaccgcggaggcgcgggaagctctcggcgtcggaggaccggctcgcgggtttcc
gtccagggtggtagtgggcccaaggtagaagaggacgaggtgcgagacgcggctgtgagc
cccgacttgggcgccgggggtgacgcgccggctccggctccggctccagcccatacccgg
gacaaagacgggcggaccagcgtgggcgacggctactgggatctgaggtgccatcgtctg
caagattctttgttcagctcagacagtggtttcagcaattatcgtggtatcctgaattgg
tgtgtggtgatgctgatcctgagtaatgcaaggttatttttagagaaccttatcaagtat
ggcatcctggtggatcctatccaggtggtgtctctgtttctgaaggacccctacagctgg
cctgccccatgcgtgattattgcatccaatatttttgttgtggctgcatttcagattgag
aagcgcctggcagtgggtgccctgacagagcagatggggctgctgctacatgtggttaac
ctggccacaatcatctgcttcccagcagctgtggccttactggttgagtctatcactcca
gtgggttccgtgtttgctctggcatcatactccatcatgttcctcaagctttattcctac
cgggatgtcaacctgtggtgccgccagcgaagggtcaaggccaaagctgtctctacaggg
aagaaggtcagtggggctgctgcccagcaagctgtgagctatccagacaacctgacctac
cgagatctctattacttcatctttgctcctactttgtgttatgaactcaactttcctcgg
tccccccgaatacgaaagcgctttctgctacgacgagttcttgagatgctcttttttacc
cagcttcaagtggggctgatccaacagtggatggtccctactatccagaactccatgaag
cccttcaaggatatggactattcacggatcattgagcgtctcttaaagctggcggtcccc
aaccatctgatctggcttatcttcttctattggtttttccactcctgtctcaatgctgtg
gcagagcttctgcagtttggagaccgcgagttctacagagattggtggaatgctgagtct
gtcacctacttttggcagaactggaatatccccgtgcacaagtggtgcatcagacacttc
tacaagcctatgctcagacatggcagcagcaaatgggtggccaggacaggagtatttttg
acctcagccttcttccatgagtacctagtgagcgttcccctgcggatgttccgcctctgg
gcattcacagccatgatggctcaggtcccactggcctggattgtgggccgattcttccaa
gggaactatggcaatgcagctgtgtgggtgacactcatcattgggcaaccggtggctgtg
ctcatgtatgtccacgactactacgtgctcaactacgatgccccagtgggggtctga

DBGET integrated database retrieval system