KEGG   Mus musculus (house mouse): 13358
Entry
13358             CDS       T01002                                 
Symbol
Slc25a1, 1300019P08Rik, 2610100G11Rik, AI194714, Ctp, Dgsj, Slc20a3
Name
(RefSeq) solute carrier family 25 (mitochondrial carrier, citrate transporter), member 1
  KO
K15100  solute carrier family 25 (mitochondrial citrate transporter), member 1
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    13358 (Slc25a1)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   13358 (Slc25a1)
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 13358
NCBI-ProteinID: NP_694790
MGI: 1345283
Ensembl: ENSMUSG00000003528
UniProt: Q8JZU2
Position
16:complement(17743075..17746083)
AA seq 311 aa
MAAPRGPRALSAAAPGSGKPKLTHPGKAILAGGLAGGIEICITFPTEYVKTQLQLDERAN
PPRYRGIGDCVRQTVRSHGVLGLYRGLSSLLYGSIPKAAVRFGMFEFLSNHMRDAQGRLD
SRRGLLCGLGAGVAEAVVVVCPMETIKVKFIHDQTSSNPKYRGFFHGVREIIREQGLKGT
YQGLTATVLKQGSNQAIRFFVMTSLRNWYQGDNHNKPMNPLITGVFGATAGAASVFGNTP
LDVIKTRMQGLEAHKYRNTLDCGLKILKNEGPKAFYKGTVPRLGRVCLDVAIVFIIYDEV
VKLLNKVWKTD
NT seq 936 nt   +upstreamnt  +downstreamnt
atggctgcgcctcgcgggccccgcgctctgtcggccgccgcgccggggtccgggaagccc
aaactgacgcaccccgggaaggcaatcctagcaggcggcctggctggaggcatcgaaatc
tgcatcaccttcccgaccgaatacgtgaagacgcagctgcagctagatgaacgagcgaac
ccaccgcggtaccggggcatcggagactgcgtgcggcaaactgtccgcagccatggcgtc
ctgggcctgtaccgcggcctcagctccttgctctacggctccatccccaaggcggctgtc
aggtttgggatgttcgagttcctcagcaaccacatgcgggatgcccaaggtaggctcgac
agcaggagaggactattgtgcggtctgggtgccggcgtggcagaagcagtggtagtcgtg
tgccctatggagaccatcaaggtgaagttcatccatgaccagacttcctccaaccccaag
taccgaggatttttccacggggttagagagattattcgggaacaagggctaaagggaaca
taccaaggccttactgcgactgtactgaagcagggctcaaaccaagccatccgattcttt
gtcatgacctccctacgcaactggtaccaaggagacaaccacaacaaacctatgaaccca
ctgatcacgggggtctttggagctactgcgggtgcagccagtgtctttggaaacacacct
ttggatgtgatcaagaccaggatgcagggcctggaggcacacaaataccggaacaccctg
gactgcggcttgaagatcctaaagaatgaggggccaaaggcattctacaagggcaccgtt
ccccggctgggccgagtctgcctggatgtggccatcgtattcatcatctacgatgaagtg
gtgaagctgctcaataaagtgtggaagacagactaa

DBGET integrated database retrieval system