KEGG   Mus musculus (mouse): 13361Help
Entry
13361             CDS       T01002                                 

Gene name
Dhfr, 8430436I03Rik, AA607882, AI662710, AW555094
Definition
(RefSeq) dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00670  One carbon pool by folate
mmu00790  Folate biosynthesis
mmu01100  Metabolic pathways
mmu01523  Antifolate resistance
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    13361 (Dhfr)
   00670 One carbon pool by folate
    13361 (Dhfr)
 Human Diseases
  Drug resistance
   01523 Antifolate resistance
    13361 (Dhfr)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     13361 (Dhfr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHFR_1 VWA_3
Motif
Other DBs
NCBI-GeneID: 13361
NCBI-ProteinID: NP_034179
MGI: 94890
Ensembl: ENSMUSG00000021707
UniProt: P00375 Q544T5
Structure
PDB: 

Position
13 C3; 13 47.64 cM
AA seq 187 aa AA seqDB search
MVRPLNCIVAVSQNMGIGKNGDLPWPPLRNEFKYFQRMTTTSSVEGKQNLVIMGRKTWFS
IPEKNRPLKDRINIVLSRELKEPPRGAHFLAKSLDDALRLIEQPELASKVDMVWIVGGSS
VYQEAMNQPGHLRLFVTRIMQEFESDTFFPEIDLGKYKLLPEYPGVLSEVQEEKGIKYKF
EVYEKKD
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atggttcgaccattgaactgcatcgtcgccgtgtcccaaaatatggggattggcaagaac
ggagacctaccctggcctccgctcaggaacgagttcaagtacttccaaagaatgaccaca
acctcttcagtggaaggtaaacagaatctggtgattatgggtaggaaaacctggttctcc
attcctgagaagaatcgacctttaaaggacagaattaatatagttctcagtagagaactc
aaagaaccaccacgaggagctcattttcttgccaaaagtttggatgatgccttaagactt
attgaacaaccggaattggcaagtaaagtagacatggtttggatagtcggaggcagttct
gtttaccaggaagccatgaatcaaccaggccacctcagactctttgtgacaaggatcatg
caggaatttgaaagtgacacgtttttcccagaaattgatttggggaaatataaacttctc
ccagaatacccaggcgtcctctctgaggtccaggaggaaaaaggcatcaagtataagttt
gaagtctacgagaagaaagactaa

DBGET integrated database retrieval system