KEGG   Mus musculus (mouse): 13367
Entry
13367             CDS       T01002                                 

Gene name
Diaph1, D18Wsu154e, Dia1, Diap1, Drf1, p140mDia
Definition
(RefSeq) diaphanous related formin 1
  KO
K05740  diaphanous 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04510  Focal adhesion
mmu04810  Regulation of actin cytoskeleton
mmu04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    13367 (Diaph1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    13367 (Diaph1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    13367 (Diaph1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    13367 (Diaph1)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Formins
     13367 (Diaph1)
SSDB
Motif
Pfam: FH2 Drf_FH3 Drf_GBD Drf_FH1 Drf_DAD DUF3450 Rootletin ADIP
Other DBs
NCBI-GeneID: 13367
NCBI-ProteinID: NP_031884
MGI: 1194490
Ensembl: ENSMUSG00000024456
Vega: OTTMUSG00000021095
UniProt: O08808
Structure
PDB: 

Position
18 B3; 18 19.71 cM
AA seq 1255 aa
MEPSGGGLGPGRGTRDKKKGRSPDELPATGGDGGKHKKFLERFTSMRIKKEKEKPNSAHR
NSSASYGDDPTAQSLQDISDEQVLVLFEQMLVDMNLNEEKQQPLREKDIVIKREMVSQYL
HTSKAGMNQKESSRSAMMYIQELRSGLRDMHLLSCLESLRVSLNNNPVSWVQTFGAEGLA
SLLDILKRLHDEKEETSGNYDSRNQHEIIRCLKAFMNNKFGIKTMLETEEGILLLVRAMD
PAVPNMMIDAAKLLSALCILPQPEDMNERVLEAMTERAEMDEVERFQPLLDGLKSGTSIA
LKVGCLQLINALITPAEELDFRVHIRSELMRLGLHQVLQELREIENEDMKVQLCVFDEQG
DEDFFDLKGRLDDIRMEMDDFGEVFQIILNTVKDSKAEPHFLSILQHLLLVRNDYEARPQ
YYKLIEECVSQIVLHKNGTDPDFKCRHLQIDIERLVDQMIDKTKVEKSEAKATELEKKLD
SELTARHELQVEMKKMENDFEQKLQDLQGEKDALDSEKQQITAQKQDLEAEVSKLTGEVA
KLSKELEDAKNEMASLSAVVVAPSVSSSAAVPPAPPLPGDSGTVIPPPPPPPPLPGGVVP
PSPPLPPGTCIPPPPPLPGGACIPPPPQLPGSAAIPPPPPLPGVASIPPPPPLPGATAIP
PPPPLPGATAIPPPPPLPGGTGIPPPPPPLPGSVGVPPPPPLPGGPGLPPPPPPFPGAPG
IPPPPPGMGVPPPPPFGFGVPAAPVLPFGLTPKKVYKPEVQLRRPNWSKFVAEDLSQDCF
WTKVKEDRFENNELFAKLTLAFSAQTKTSKAKKDQEGGEEKKSVQKKKVKELKVLDSKTA
QNLSIFLGSFRMPYQEIKNVILEVNEAVLTESMIQNLIKQMPEPEQLKMLSELKEEYDDL
AESEQFGVVMGTVPRLRPRLNAILFKLQFSEQVENIKPEIVSVTAACEELRKSENFSSLL
ELTLLVGNYMNAGSRNAGAFGFNISFLCKLRDTKSADQKMTLLHFLAELCENDHPEVLKF
PDELAHVEKASRVSAENLQKSLDQMKKQIADVERDVQNFPAATDEKDKFVEKMTSFVKDA
QEQYNKLRMMHSNMETLYKELGDYFVFDPKKLSVEEFFMDLHNFRNMFLQAVKENQKRRE
TEEKMRRAKLAKEKAEKERLEKQQKREQLIDMNAEGDETGVMDSLLEALQSGAAFRRKRG
PRQVNRKAGCAVTSLLASELTKDDAMAPGPVKVPKKSEGVPTILEEAKELVGRAS
NT seq 3768 nt   +upstreamnt  +downstreamnt
atggagccgtccggcgggggcctggggcccggccgcggtacccgggacaagaagaagggt
cggagcccggatgagctgcctgcgacgggcggcgacggcggcaaacataagaaatttctg
gagagatttaccagcatgaggattaagaaggagaaagaaaagcccaattctgctcataga
aactcctctgcatcgtacggagatgaccccactgctcagtcattgcaggacatctcagac
gagcaagttcttgtcctctttgagcagatgctggtggatatgaacctgaatgaggagaag
cagcagcctttgcgagagaaggacattgtcatcaagagggagatggtgtcgcaatatctg
cacacttccaaggctggcatgaaccagaaagagagctctaggtctgccatgatgtacatc
caggagctgaggtcgggcttgcgggatatgcacctgcttagctgccttgagtcccttcga
gtctctctcaacaataaccctgtcagttgggtgcagacatttggtgctgagggcctagcc
tccttattggacatcctcaaacgactccatgatgagaaagaggagacttctggaaactac
gacagccgaaaccagcatgagattatccgctgtttgaaggctttcatgaacaacaagttt
ggaatcaaaactatgttggagacggaagaaggaatcctactgctggtcagagccatggat
cctgctgttcccaatatgatgattgatgcagcaaagctgctgtctgccctctgtatcctg
ccgcagccggaggacatgaatgaacgagttctagaggcaatgacagagagagctgaaatg
gatgaggtcgaacgcttccagccacttctggacggattaaaaagtgggacctctattgcc
ctcaaagtgggatgcctacagctcatcaatgctctcatcactccagctgaggaactggac
ttccgagttcacatccgaagtgagctgatgcgcctggggctgcatcaggtgttgcaggag
cttcgagagattgaaaatgaagatatgaaagtacagctgtgcgtgtttgatgaacaaggg
gatgaagatttctttgatctgaagggacggctggatgatatccgcatggagatggatgac
tttggtgaagtttttcagattattttaaacacagtgaaagattcaaaggcagagccacac
ttcctgtctatcttgcagcatctcctgttggtccgaaatgattatgaagccaggccacag
tactataaactgattgaagaatgtgtttctcagatagttctacacaaaaatggaactgat
cctgacttcaagtgccgacacctgcagattgatattgagagattggttgatcaaatgatt
gataaaacaaaggtggaaaaatctgaggccaaagctacagagctggaaaaaaagttggat
tcagaattaacagcgcggcacgagttacaagtagaaatgaaaaagatggaaaatgacttt
gagcagaaacttcaggatcttcaaggagaaaaggatgccttggattctgaaaagcagcag
atcactgcacagaaacaagacctggaggcagaggtgtccaagctgacaggagaggttgcc
aagctgtcaaaagaactagaagatgccaagaatgaaatggcttctctctctgctgtggtt
gttgcaccttctgtttctagcagtgctgctgttccccctgcccctcctctgcctggtgac
tctggcactgttattccacctcccccacccccacctcctcttcctggaggtgtggtccca
ccatcccctcctctgcctccaggtacttgtatccctccacctcctcctttacctggaggt
gcttgtataccccctcccccccagttgcctggcagtgctgccatccctccacctcctcct
ctacctggagttgcttccatccccccacctccccctttgcctggggctactgccatcccc
ccacctccccctttgcctggggctactgccatccccccacctccccctttgcctggaggt
acaggtataccaccaccacctcctcctttgcctggaagtgttggcgttcccccaccccct
cccttgcctggaggaccaggactgcctcctccccctcccccttttcctggagcacctggc
attcctccacctccacctggtatgggcgtgcctccacctcccccctttggatttggggtt
cctgcggccccagttctgccatttggattaacccccaaaaaagtttataagccagaggtg
cagctccggaggccaaactggtccaagtttgtggctgaggacctttcccaggactgcttc
tggacaaaggtgaaggaggaccgctttgagaacaatgaactttttgccaaacttaccctt
gccttctccgcccagaccaagacttctaaagccaagaaggatcaagaaggtggagaagaa
aagaaatctgttcaaaagaagaaagtaaaagagctgaaagtgctggattcaaagacagcg
cagaatctctcaatctttttgggttcattccgcatgccctatcaagagataaagaacgtt
atcctggaggtgaatgaggctgttctcacagagtctatgatccagaacctcattaaacag
atgccagagccagagcagctaaagatgctctctgaactgaaggaggagtacgatgatctg
gctgagtcagagcagtttggtgtggtgatgggcacagtgccccgccttcggcctcgcctc
aacgccatcctcttcaagctacagttcagtgagcaagttgagaacatcaagccagagatc
gtgtctgtcaccgccgcatgcgaagagctgcgtaagagtgagaacttctccagcctcctg
gagctcacactgctggtcggaaactatatgaatgcgggctccaggaatgctggtgctttc
ggcttcaatatcagcttcctttgtaagcttcgagacaccaagtctgcagatcagaagatg
actctgttgcatttcttggctgagttatgtgagaatgaccaccccgaagtcctcaagttt
cctgatgagcttgcccatgtagagaaagccagcagagtctctgctgagaacctgcagaag
agcttagatcagatgaagaagcagattgcggacgtggagcgcgatgttcagaatttccca
gctgccactgacgagaaggacaagtttgttgagaagatgaccagctttgtgaaggatgca
caggaacagtataacaaactacggatgatgcactccaacatggagaccctctataaggag
ctaggtgactacttcgtctttgaccctaagaagttgtctgtagaggaattctttatggat
ctgcacaactttaggaatatgtttttgcaagcagtcaaggaaaaccagaagcgccgggaa
acagaagaaaagatgcggagagcaaaattagccaaggagaaggcagaaaaagagcgactg
gagaagcagcagaagcgcgagcagctcatcgacatgaacgcagagggggatgagacaggt
gtgatggacagtcttctagaagctctgcagtcaggggcagcattccgacggaagagaggg
ccccggcaggtcaacaggaaggctgggtgtgcagtcacatctctgctagcctcggagctg
accaaggatgatgccatggctcctggtcctgttaaggtacccaagaaaagtgaaggagtc
cccacaatcctggaagaagccaaggagctggttggccgtgcaagctaa

DBGET integrated database retrieval system