KEGG   Mus musculus (house mouse): 13380
Entry
13380             CDS       T01002                                 
Symbol
Dkk1, mdkk-1
Name
(RefSeq) dickkopf WNT signaling pathway inhibitor 1
  KO
K02165  dickkopf 1/2/4
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04310  Wnt signaling pathway
mmu05010  Alzheimer disease
mmu05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    13380 (Dkk1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    13380 (Dkk1)
   05022 Pathways of neurodegeneration - multiple diseases
    13380 (Dkk1)
SSDB
Motif
Pfam: Dickkopf_N Toxin_19
Other DBs
NCBI-GeneID: 13380
NCBI-ProteinID: NP_034181
MGI: 1329040
Ensembl: ENSMUSG00000024868
Vega: OTTMUSG00000020350
UniProt: O54908
Position
19:complement(30523276..30526896)
AA seq 272 aa
MMVVCAAAAVRFLAVFTMMALCSLPLLGASATLNSVLINSNAIKNLPPPLGGAGGQPGSA
VSVAPGVLYEGGNKYQTLDNYQPYPCAEDEECGSDEYCSSPSRGAAGVGGVQICLACRKR
RKRCMRHAMCCPGNYCKNGICMPSDHSHFPRGEIEESIIENLGNDHNAAAGDGYPRRTTL
TSKIYHTKGQEGSVCLRSSDCAAGLCCARHFWSKICKPVLKEGQVCTKHKRKGSHGLEIF
QRCYCGEGLACRIQKDHHQASNSSRLHTCQRH
NT seq 819 nt   +upstreamnt  +downstreamnt
atgatggttgtgtgtgcagcggcagctgtccggttcttggccgtgtttacaatgatggct
ctctgcagcctccctctgctaggagccagtgccaccttgaactcagttctcatcaattcc
aacgcgatcaagaacctgcccccaccgctgggtggtgctggggggcagccgggctctgct
gtcagtgtggcgccgggagttctctatgagggcgggaacaagtaccagactcttgacaac
taccagccctacccttgcgctgaagatgaggagtgcggctctgacgagtactgctccagc
cccagccgcggggcagccggcgtcggaggtgtacagatctgtctggcttgccgaaagcgc
aggaagcgctgcatgaggcacgctatgtgctgccccgggaactactgcaaaaatggaata
tgcatgccctctgaccacagccattttcctcgaggggaaattgaggaaagcatcattgaa
aaccttggtaatgaccacaacgccgccgcgggggatggatatcccagaagaaccacactg
acttcaaaaatatatcacaccaaaggacaagaaggctccgtctgcctccgatcatcagac
tgtgccgcagggctgtgttgtgcaagacacttctggtccaagatctgtaaacctgtcctt
aaagaaggtcaggtgtgcaccaagcacaaacggaaaggctcccacgggctggagatattc
cagcgctgttactgcggggaaggcctggcttgcaggatacagaaagatcaccatcaagcc
agcaattcttctaggctccacacctgccagagacactaa

DBGET integrated database retrieval system