KEGG   Mus musculus (mouse): 13380
Entry
13380             CDS       T01002                                 

Gene name
Dkk1, mdkk-1
Definition
(RefSeq) dickkopf WNT signaling pathway inhibitor 1
  KO
K02165  dickkopf
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04310  Wnt signaling pathway
mmu05010  Alzheimer disease
mmu05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    13380 (Dkk1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    13380 (Dkk1)
   05022 Pathways of neurodegeneration - multiple diseases
    13380 (Dkk1)
SSDB
Motif
Pfam: Dickkopf_N Toxin_19
Other DBs
NCBI-GeneID: 13380
NCBI-ProteinID: NP_034181
MGI: 1329040
Ensembl: ENSMUSG00000024868
Vega: OTTMUSG00000020350
UniProt: O54908
Position
19; 19 C1
AA seq 272 aa
MMVVCAAAAVRFLAVFTMMALCSLPLLGASATLNSVLINSNAIKNLPPPLGGAGGQPGSA
VSVAPGVLYEGGNKYQTLDNYQPYPCAEDEECGSDEYCSSPSRGAAGVGGVQICLACRKR
RKRCMRHAMCCPGNYCKNGICMPSDHSHFPRGEIEESIIENLGNDHNAAAGDGYPRRTTL
TSKIYHTKGQEGSVCLRSSDCAAGLCCARHFWSKICKPVLKEGQVCTKHKRKGSHGLEIF
QRCYCGEGLACRIQKDHHQASNSSRLHTCQRH
NT seq 819 nt   +upstreamnt  +downstreamnt
atgatggttgtgtgtgcagcggcagctgtccggttcttggccgtgtttacaatgatggct
ctctgcagcctccctctgctaggagccagtgccaccttgaactcagttctcatcaattcc
aacgcgatcaagaacctgcccccaccgctgggtggtgctggggggcagccgggctctgct
gtcagtgtggcgccgggagttctctatgagggcgggaacaagtaccagactcttgacaac
taccagccctacccttgcgctgaagatgaggagtgcggctctgacgagtactgctccagc
cccagccgcggggcagccggcgtcggaggtgtacagatctgtctggcttgccgaaagcgc
aggaagcgctgcatgaggcacgctatgtgctgccccgggaactactgcaaaaatggaata
tgcatgccctctgaccacagccattttcctcgaggggaaattgaggaaagcatcattgaa
aaccttggtaatgaccacaacgccgccgcgggggatggatatcccagaagaaccacactg
acttcaaaaatatatcacaccaaaggacaagaaggctccgtctgcctccgatcatcagac
tgtgccgcagggctgtgttgtgcaagacacttctggtccaagatctgtaaacctgtcctt
aaagaaggtcaggtgtgcaccaagcacaaacggaaaggctcccacgggctggagatattc
cagcgctgttactgcggggaaggcctggcttgcaggatacagaaagatcaccatcaagcc
agcaattcttctaggctccacacctgccagagacactaa

KEGG   Mus musculus (mouse): 234130
Entry
234130            CDS       T01002                                 

Gene name
Dkk4, Dkk-4
Definition
(RefSeq) dickkopf WNT signaling pathway inhibitor 4
  KO
K02165  dickkopf
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04310  Wnt signaling pathway
mmu05010  Alzheimer disease
mmu05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    234130 (Dkk4)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    234130 (Dkk4)
   05022 Pathways of neurodegeneration - multiple diseases
    234130 (Dkk4)
SSDB
Motif
Pfam: Dickkopf_N Prokineticin DX
Other DBs
NCBI-GeneID: 234130
NCBI-ProteinID: NP_663567
MGI: 2385299
Ensembl: ENSMUSG00000031535
Vega: OTTMUSG00000060892
UniProt: Q8VEJ3
Position
8; 8 A2
AA seq 221 aa
MVLVTLLGLSWFCSPLAALVLDFNNIKSSADVQGAGKGSLCASDRDCSEGKFCLAFHDER
SFCATCRRVRRRCQRSAVCCPGTVCVNDVCTAVEDTRPVMDRNTDGQDGAYAEGTTKWPA
EENRPQGKPSTKKSQSSKGQEGESCLRTSDCGPGLCCARHFWTKICKPVLREGQVCSRRG
HKDTAQAPEIFQRCDCGPGLTCRSQVTSNRQHSRLRVCQRI
NT seq 666 nt   +upstreamnt  +downstreamnt
atggtactggtgaccttgcttggactcagctggttttgttcacccctggcagccctggtt
ctggactttaacaacatcaagagctccgcggatgtgcaaggcgcggggaagggctcgctg
tgtgcatcagacagggactgcagcgaagggaaattctgcttagcgtttcacgatgaacgg
tccttctgtgccacgtgccgtagagttcgcaggaggtgtcagaggagcgccgtgtgctgc
ccaggaacggtctgtgtgaatgatgtttgcactgcagtggaagacacaaggccagtgatg
gacagaaacactgacggccaagacggcgcctatgcagaaggaaccactaaatggccagca
gaggaaaacagacctcaggggaagcccagtacgaagaaatcacaaagcagtaagggacag
gagggagaaagctgtcttagaacctctgactgtggccctggactttgctgtgctcgccat
ttttggacaaaaatttgcaagccagttctacgagagggacaagtctgctccaggaggggg
cacaaagacactgcccaagccccagaaatcttccagcgttgcgactgcgggcctggacta
acgtgccgaagtcaggtgaccagtaacagacaacattcaaggctaagagtatgccaaaga
atataa

KEGG   Mus musculus (mouse): 56811
Entry
56811             CDS       T01002                                 

Gene name
Dkk2
Definition
(RefSeq) dickkopf WNT signaling pathway inhibitor 2
  KO
K02165  dickkopf
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04310  Wnt signaling pathway
mmu05010  Alzheimer disease
mmu05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    56811 (Dkk2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    56811 (Dkk2)
   05022 Pathways of neurodegeneration - multiple diseases
    56811 (Dkk2)
SSDB
Motif
Pfam: Dickkopf_N DUF4501
Other DBs
NCBI-GeneID: 56811
NCBI-ProteinID: NP_064661
MGI: 1890663
Ensembl: ENSMUSG00000028031
Vega: OTTMUSG00000054905
UniProt: Q9QYZ8
Structure
PDB: 
2JTK

Position
3; 3 G3
AA seq 259 aa
MAALMRVKDSSRCLLLLAAVLMVESSQLGSSRAKLNSIKSSLGGETPAQSANRSAGMNQG
LAFGGSKKGKSLGQAYPCSSDKECEVGRYCHSPHQGSSACMLCRRKKKRCHRDGMCCPGT
RCNNGICIPVTESILTPHIPALDGTRHRDRNHGHYSNHDLGWQNLGRPHSKMPHIKGHEG
DPCLRSSDCIDGFCCARHFWTKICKPVLHQGEVCTKQRKKGSHGLEIFQRCDCAKGLSCK
VWKDATYSSKARLHVCQKI
NT seq 780 nt   +upstreamnt  +downstreamnt
atggccgcgctgatgcgggtcaaggattcatcccgctgccttctcctactggccgcggtg
ctgatggtggagagctcacagctaggcagctcgcgggccaaactcaactccatcaagtcc
tctctaggaggggagactcctgctcagtcagccaaccgatctgcaggcatgaaccaagga
ctggctttcggcggcagtaagaagggcaaaagcctggggcaggcctacccttgcagcagt
gataaggaatgtgaagttggaagatactgccacagtccccaccaaggatcatcagcctgc
atgctctgtaggaggaaaaagaaacgatgccacagagatgggatgtgttgccctggtacc
cgctgcaataatggaatctgcatcccagtcactgagagcatcctcaccccacatatccca
gctctggatggcacccggcatagagatcgcaaccatggtcactattccaaccatgacctg
ggatggcagaatctaggaaggccacactccaagatgcctcatataaaaggacatgaagga
gacccatgcctacggtcatcagactgcattgatgggttttgttgtgctcgccacttctgg
accaaaatctgcaaaccagtgctccatcagggggaagtctgtaccaaacaacgcaagaag
ggttcgcacgggctggagattttccagaggtgtgactgtgcaaagggcctgtcctgcaaa
gtgtggaaagatgccacctactcttccaaagccagactccatgtatgccagaagatctga

DBGET integrated database retrieval system