KEGG   Mus musculus (mouse): 13382
Entry
13382             CDS       T01002                                 

Gene name
Dld
Definition
(RefSeq) dihydrolipoamide dehydrogenase
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00010  Glycolysis / Gluconeogenesis
mmu00020  Citrate cycle (TCA cycle)
mmu00260  Glycine, serine and threonine metabolism
mmu00280  Valine, leucine and isoleucine degradation
mmu00310  Lysine degradation
mmu00380  Tryptophan metabolism
mmu00620  Pyruvate metabolism
mmu00630  Glyoxylate and dicarboxylate metabolism
mmu00640  Propanoate metabolism
mmu01100  Metabolic pathways
mmu01200  Carbon metabolism
mmu01240  Biosynthesis of cofactors
Module
mmu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mmu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mmu_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
mmu_M00036  Leucine degradation, leucine => acetoacetate + acetyl-CoA
mmu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    13382 (Dld)
   00020 Citrate cycle (TCA cycle)
    13382 (Dld)
   00620 Pyruvate metabolism
    13382 (Dld)
   00630 Glyoxylate and dicarboxylate metabolism
    13382 (Dld)
   00640 Propanoate metabolism
    13382 (Dld)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    13382 (Dld)
   00280 Valine, leucine and isoleucine degradation
    13382 (Dld)
   00310 Lysine degradation
    13382 (Dld)
   00380 Tryptophan metabolism
    13382 (Dld)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    13382 (Dld)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     13382 (Dld)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   13382 (Dld)
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 FAD_oxidored NAD_binding_8 FAD_binding_2 GIDA AlaDh_PNT_C K_oxygenase HI0933_like FAD_binding_3 Thi4
Other DBs
NCBI-GeneID: 13382
NCBI-ProteinID: NP_031887
MGI: 107450
Ensembl: ENSMUSG00000020664
UniProt: O08749
Position
12 A2; 12 13.43 cM
AA seq 509 aa
MQSWSRVYRSLAKKGHFNRISHGLQGVSSVPLRTYADQPIEADVTVIGSGPGGYVAAIKS
AQLGFKTVCIEKNETLGGTCLNVGCIPSKALLNNSHYYHMAHGKDFASRGIEIPEVRLNL
EKMMEQKHSAVKALTGGIAHLFKQNKVVHVNGFGKITGKNQVTATKADGSTQVIDTKNIL
VATGSEVTPFPGITIDEDTIVSSTGALSLKKVPEKLVVIGAGVIGVELGSVWQRLGADVT
AVEFLGHVGGIGIDMEISKNFQRILQRQGFKFKLNTKVTGATKKSDGKIDVSVEAASGGK
AEVITCDVLLVCIGRRPFTQNLGLEELGIELDPKGRIPVNNRFQTKIPNIYAIGDVVAGP
MLAHKAEDEGIICVEGMAGGAVHIDYNCVPSVIYTHPEVAWVGKSEEQLKEEGIEFKIGK
FPFAANSRAKTNADTDGMVKILGHKSTDRVLGAHILGPGAGEMVNEAALALEYGASCEDI
ARVCHAHPTLSEAFREANLAAAFGKPINF
NT seq 1530 nt   +upstreamnt  +downstreamnt
atgcagagctggagtcgtgtgtaccgctccttggccaagaaaggccatttcaatcggata
tctcatggcctacaaggagtttcttcagttcctttaagaacttatgcagatcaaccaatt
gaggctgacgtgacagtgataggttctggccctggaggatatgttgctgccatcaaatct
gcccagttaggctttaagacagtctgcattgagaaaaatgagacactaggtggaacatgc
ttgaacgttggttgtattccttcaaaggctttattaaataattctcattattaccatatg
gcccacggaaaagattttgcatctaggggaattgaaataccagaagttcgcttgaattta
gagaagatgatggagcagaagcattctgcagtaaaagcattaacagggggaattgctcac
ttattcaaacaaaataaggttgttcacgtcaatggatttggaaagataaccggcaagaat
caagttacagctacaaaagccgatggcagcactcaggttattgataccaaaaacatcctt
gtagctacgggctcagaagttactccttttcctggaatcacgatcgatgaagatactata
gtgtcatctacaggagctttatccttaaaaaaagttccagagaagctggttgttattggg
gcaggagtaattggtgtggaactgggttcagtttggcaaagacttggtgcagatgtgaca
gcagttgaatttttgggtcatgtgggtggaattggaattgacatggagatatcaaaaaat
tttcaacgtatacttcagaggcaaggatttaagtttaaactgaatacaaaagttactggt
gccaccaagaagtcagatggaaaaattgatgtgtctgtcgaagctgcttctggtggtaaa
gctgaagttatcacttgtgatgtactcttggtttgcattggtcggcggccctttactcag
aatttgggactagaagagcttggaattgaactagatcccaaaggtagaattccagtcaat
aacagatttcaaactaaaattccaaatatctatgctattggagatgtggtcgctggtcca
atgttggctcacaaagcagaagatgaaggcatcatctgtgttgaagggatggccggcggt
gctgtgcacattgattataattgtgtgccatcagtgatttacacacaccccgaggttgct
tgggttggcaaatcggaagaacagttgaaagaagagggtattgagttcaaaattggaaaa
ttcccctttgctgcaaacagcagagctaaaacaaatgctgacacagatggcatggtgaag
attcttggacataagtcaacagatagagtgctgggagcacatattctaggaccaggtgct
ggagaaatggtgaacgaggcggccctggcattggaatatggtgcttcctgtgaagatata
gctcgagtctgccatgcgcatccgaccttatcagaggcttttagagaagcaaacttggct
gcagcttttggaaaaccaatcaacttttaa

DBGET integrated database retrieval system