KEGG   Mus musculus (mouse): 13401
Entry
13401             CDS       T01002                                 

Gene name
Dmwd, DMR-, DMR-N9, Dm9
Definition
(RefSeq) dystrophia myotonica-containing WD repeat motif
  KO
K24731  dystrophia myotonica WD repeat-containing protein
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    13401 (Dmwd)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 WD40 repeat (WDR) domain-containing proteins
  Other WDR domain-containing proteins
   13401 (Dmwd)
Motif
Pfam: WD40
Other DBs
NCBI-GeneID: 13401
NCBI-ProteinID: NP_034188
MGI: 94907
Ensembl: ENSMUSG00000030410
Vega: OTTMUSG00000022947
UniProt: Q08274 Q5HZG7
Position
7 A3; 7 9.46 cM
AA seq 665 aa
MAAGGAEGGPGPSAAMGDCAEIKSQFRTREGFYKLLPGDATRRSGPTSAQTPAPPQPTQP
PPGPAAASGPGAAGPASSPPPAGPGPGPALPAVRLSLVRLGDPDGAGEPPSTPSGLGAGG
DRVCFNLGRELYFYPGCCRSGSQRSIDLNKPIDKRIYKGTQPTCHDFNQFTAATETISLL
VGFSAGQVQYLDLIKKDTSKLFNEERLIDKTKVTYLKWLPESESLFLASHASGHLYLYNV
SHPCTSTPPQYSLLKQGEGFAVYAAKSKAPRNPLAKWAVGEGPLNEFAFSPDGRHLACVS
QDGCLRVFHFDSMLLRGLMKSYFGGLLCVCWSPDGRYVVTGGEDDLVTVWSFTEGRVVAR
GHGHKSWVNAVAFDPYTTRAEEAASASADGDPSGEEEEPEVTSSDTGAPVSPLPKAGSIT
YRFGSAGQDTQFCLWDLTEDVLSPHPSLARTRTLPGTPGATPPASGSSRAGETGAGPLPR
SLSRSNSLPHPAGGGKAGGPSASMEPGIPFSIGRFATLTLQERRDRGAEKEHKRYHSLGN
ISRGGSGGNSSNDKLSGPAPRSRLDPAKVLGTALCPRIHEVPLLEPLVCKKIAQERLTVL
LFLEDCIITACQEGLICTWARPGKAFTDEETEAQAGQASWPRSPSKSVVEGISSQPGSSP
SGTVV
NT seq 1998 nt   +upstreamnt  +downstreamnt
atggcggcgggcggcgcggagggcggcccgggccccagcgccgccatgggcgactgcgcg
gagatcaagtcgcagtttcgcacccgcgagggcttctacaagctgctccccggcgacgcg
acgcgcaggtcgggcccgacctccgctcagaccccggcgccgcctcagcccactcagccc
ccgcccgggcccgccgcagcctccgggcccggcgccgcgggtcccgcgtcgtccccgccg
cccgccggccccgggcccgggcccgcgctgcccgccgtccgcctcagcctggtgcgccta
ggcgacccggatggcgctggggagccgccctccacgccctccggactgggcgcgggagga
gaccgcgtctgcttcaacctgggccgggagctttatttctaccccggctgctgccgcagc
gggagccagcggtccatcgatctcaacaagcccatcgacaagcggatctacaaggggacc
cagcccacctgccacgacttcaaccagttcacagctgccacagagaccatttccctgctg
gtgggcttctctgccggccaggtgcagtatctggacctcatcaagaaagacaccagcaag
ctattcaatgaagagcggctgattgacaagaccaaggtgacatatttgaagtggctgcct
gagtcagagagtctgttccttgcttctcacgccagtggccacctgtacctctacaacgtc
agtcacccctgcacctccaccccaccccagtatagtctgctgaaacagggtgagggcttt
gctgtctatgcagccaaaagcaaggcaccccgcaatccactagccaagtgggcagtgggt
gaggggcccctcaatgagtttgcattctcacctgatggccgacacttagcctgtgtcagc
caggatggctgcctgcgtgtcttccactttgacagcatgcttctgcgtgggctcatgaag
agctactttgggggtctgctgtgtgtgtgctggagccctgatggccgctacgtggtgaca
ggaggggaagatgacttagtcactgtgtggtccttcacggagggtcgtgtggtggctcga
ggccatggccacaagtcctgggtcaacgctgtagcctttgatccctacaccactcgcgca
gaggaggcggcgtcagccagtgctgatggagatcccagtggtgaagaggaggagcctgaa
gtcaccagctcagacacaggagccccagtgtccccactgcccaaggctggctccatcacg
taccgctttggctcagctggccaggacacacagttctgcctgtgggacctcacagaagat
gtgctctcccctcatccgtctctggcccgtacccgcacccttccgggcacacctggtgcc
accccaccagcttctggtagttctcgggccggagagacaggtgcaggccccctgccccgc
tccctgtctcgttccaacagtctcccacacccagctggtggtggcaaggctggtgggcct
agtgcatcgatggagcctggcataccattcagcattggccgctttgccacactgaccctg
caggagcggcgggaccggggagctgagaaggaacacaaacgctaccatagcctgggaaac
atcagccgcggtggcagtgggggcaatagcagcaatgacaagctcagtggtcctgccccc
cgaagccgattggacccagctaaggtgctgggcacggcactgtgccctcggatccatgag
gtgccactgctggagcctctcgtgtgcaagaagattgctcaggaacgcctgaccgtgcta
ctgttcctggaggattgtatcatcactgcctgccaagagggcctcatctgcacctgggcc
cggccaggcaaggcgttcacagacgaggagaccgaggcccaggcagggcaagcaagttgg
cccaggtcacccagcaagtcagttgtagagggcatctcctcccaaccaggcagctccccc
agtggcactgtggtgtga

DBGET integrated database retrieval system