KEGG   Mus musculus (mouse): 13404Help
Entry
13404             CDS       T01002                                 

Gene name
Dmc1, Dmc1h, Lim15, Mei11, sgdp
Definition
(RefSeq) DNA meiotic recombinase 1
  KO
K10872  meiotic recombination protein DMC1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mmu03400]
    13404 (Dmc1)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecA family proteins
     13404 (Dmc1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rad51 RecA ATPase AAA_25 HHH_5 NRD1_2 DnaB_C
Motif
Other DBs
NCBI-GeneID: 13404
NCBI-ProteinID: NP_034189
MGI: 105393
Ensembl: ENSMUSG00000022429
UniProt: Q61880 Q14AN8
Position
15 E1; 15 37.79 cM
AA seq 340 aa AA seqDB search
MKEDQVVQEESGFQDDEESLFQDIDLLQKHGINMADIKKLKSVGICTIKGIQMTTRRALC
NVKGLSEAKVEKIKEAANKLIEPGFLTAFQYSERRKMVFHITTGSQEFDKLLGGGIESMA
ITEAFGEFRTGKTQLSHTLCVTAQLPGTGGYSGGKIIFIDTENTFRPDRLRDIADRFNVD
HEAVLDNVLYARAYTSEHQMELLDYVAAKFHEEAGIFKLLIIDSIMALFRVDFSGRGELA
ERQQKLAQMLSRLQKISEEYNVAVFVTNQMTADPGATMTFQADPKKPIGGHILAHASTTR
ISLRKGRGELRIAKIYDSPEMPENEATFAITAGGIGDAKE
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaggatcaagttgtgcaggaagaatcgggattccaagatgatgaggaatctctg
tttcaagacattgacctgttgcagaagcatgggattaacatggctgatattaagaaactg
aagtctgtaggaatctgtaccattaaagggatacaaatgacaacaagaagagccctctgc
aatgtcaaaggcctctcagaagccaaagtggaaaagattaaagaggcagccaacaagctt
attgaaccaggattcctaactgcatttcagtacagtgaaaggaggaagatggtattccat
atcactactgggagccaggaatttgataaattactaggaggtggcattgaaagtatggca
attacagaagcttttggagaatttcgtactggaaaaactcagctgtctcataccctctgt
gtgacagctcaacttccaggaacaggcggctactcaggtggaaagattatcttcatcgat
acagaaaatactttccgtccagatcgccttcgggacattgctgaccgcttcaacgtagac
catgaagcagtactggacaacgtgctctatgcacgtgcctatactagtgagcatcagatg
gagctacttgattatgtcgcagccaagtttcatgaggaagctggcattttcaaactattg
atcattgactcaataatggcactttttcgagtggatttcagtggccgtggggaattggct
gaacgccagcaaaaattggcccagatgttgtcacgactccaaaaaatctcagaagaatat
aatgttgctgtttttgtgaccaatcaaatgactgcagatccaggagcaactatgaccttt
caggctgatcccaaaaaacccattggtggacacattctggctcacgcttccacaacaaga
ataagcttgcgcaagggaagaggagaactgaggatcgccaagatttatgacagccccgag
atgcctgaaaatgaagccaccttcgcaataaccgctggagggatcggggatgccaaggag
tag

DBGET integrated database retrieval system