KEGG   Mus musculus (mouse): 13406
Entry
13406             CDS       T01002                                 

Gene name
Dmp1, AG1, AV020965, DMP-1, Dmp, PP
Definition
(RefSeq) dentin matrix protein 1
  KO
K23328  dentin matrix acidic phosphoprotein 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    13406 (Dmp1)
SSDB
Motif
Pfam: DMP1
Other DBs
NCBI-GeneID: 13406
NCBI-ProteinID: NP_058059
MGI: 94910
Ensembl: ENSMUSG00000029307
Vega: OTTMUSG00000053772
UniProt: O55188
Position
5 E5; 5 50.61 cM
AA seq 503 aa
MKTVILLVFLWGLSCALPVARYHNTESESSEERTGDLAGSPPPPTNSESSEESQASPEGQ
ANSDHTDSSESGEELGYDRGQYRPAGGLSKSTGTGADKEDDEDDSGDDTFGDEDNDLGPE
EGQWGGPSKLDSDEDSTDTTQSSEDSTSQENSAQDTPSDSKDHDSEDEADSRPEAGDSTQ
DSESEEQRVGGGSEGESSHGDGSEFDDEGMQSDDPESTRSDRGHARMSSAGIRSEESKGD
HEPTSTQDSDDSQSVEFSSRKSFRRSHVSEEDYRGELTDSNSRETQSDSTEDTASKEESR
SESQEDTAESQSQEDSPEGQDPSSESSEEAGEPSQESSSESQEGVTSESRGDNPDNTSQA
GDQEDSESSEEDSLNTFSSSESQSTEEQADSESNESLSLSEESQESAQDGDSSSQEGLQS
QSASTESRSQESQSEQDSRSEEDSDSQDSSRSKEESNSTGSASSSEEDIRPKNMEADSRK
LIVDAYHNKPIGDQDDNDCQDGY
NT seq 1512 nt   +upstreamnt  +downstreamnt
atgaagactgtcattctccttgtgttcctttgggggctgtcctgtgctctcccagttgcc
agataccacaatactgaatctgaaagctctgaagagaggacgggtgatttggctgggtca
ccaccaccacccacgaacagtgagtcatcagaagaaagtcaagctagcccagagggacag
gcaaatagtgaccacacggacagcagtgaatctggagaggagctgggctacgacagaggc
cagtacagaccggctggtggactctctaagagtacggggaccggcgccgataaggaggat
gatgaagacgacagtggagatgatacctttggcgatgaggacaatgatctagggcccgaa
gaaggacagtggggaggaccctccaaactggacagtgatgaggactccacagacaccaca
cagtccagtgaagacagcacctctcaagaaaacagtgcccaagatacccccagcgacagc
aaagaccacgacagtgaggatgaggcagacagccggcctgaggcaggcgactccactcag
gacagtgagagtgaggaacagcgggtgggaggtggcagcgagggggagagtagccacggg
gacggttctgagttcgatgatgaagggatgcagagcgacgaccccgagagtaccaggagc
gatcgaggccacgccagaatgagcagcgctggtatcaggtcggaagaatctaaaggggac
cacgagcccacgagcactcaggattcagatgacagccagtctgtggaattttcaagcagg
aagtccttcagaaggtcccacgtctctgaggaagactacagaggtgagcttactgacagc
aacagcagggaaacccagagcgactccacggaggatacggcctccaaggaggaaagcagg
agcgagtctcaggaggacacagccgagagccagtcccaggaagatagcccagaggggcaa
gaccccagcagtgagtccagcgaagaggctggtgagccatcccaggaaagcagcagcgaa
tctcaggaaggggtgaccagcgagtccaggggtgacaacccagataacacaagtcaggca
ggagaccaagaagacagtgagtccagtgaggaggacagcctgaacacattctccagctca
gaaagccagtccaccgaggagcaagctgacagcgagtccaacgagagcctcagcctctcc
gaggagagtcaggagtcggcccaggatggtgacagctccagccaggaaggcctgcagtcc
cagagcgcatccactgagagcaggagccaggagagccagtctgagcaggacagccgttct
gaggaagacagtgactctcaggacagtagccgatccaaagaagagagcaactccacaggg
agcgcttccagcagcgaggaggacatccgtcccaagaacatggaagctgacagtaggaaa
ctaatagttgatgcttaccacaacaaacccatcggggaccaagatgacaatgactgtcag
gacggctactag

DBGET integrated database retrieval system