KEGG   Mus musculus (mouse): 13411Help
Entry
13411             CDS       T01002                                 

Gene name
Dnah11, Dnahc11, avc4, b2b1203Clo, b2b1279Clo, b2b1289Clo, b2b1727Clo, b2b598Clo, iv, lrd
Definition
(RefSeq) dynein, axonemal, heavy chain 11
  KO
K10408  dynein heavy chain, axonemal
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05016 Huntington disease
    13411 (Dnah11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    13411 (Dnah11)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     13411 (Dnah11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHC_N1 MT AAA_6 DHC_N2 AAA_8 Dynein_C AAA_9 AAA_7 AAA_lid_11 AAA_lid_1 Dynein_heavy AAA_5 Dynein_AAA_lid AAA_22 AAA_16 Laminin_II AAA_30 NACHT AAA_25
Motif
Other DBs
NCBI-GeneID: 13411
NCBI-ProteinID: NP_034190
MGI: 1100864
Ensembl: ENSMUSG00000018581
Vega: OTTMUSG00000040132
UniProt: E9Q7N9
Position
12 F2; 12 63.25 cM
AA seq 4488 aa AA seqDB search
MAAQEEGTVLRLSPSEQEDEEDEEAAAARRVQRFALDPRVRFLGGRLRQALRFPEETWGQ
YLESDDHRQVLGDFLESTGPASLVFSVATAGRLSASPEIPRDVKHKLVYFAKKMTENMGE
SDFSQTILFGEIPRSLLTHVTAFLDEILVPVLSNKNNHTSWSCFISQDVEHHTEVMKNKM
HIFRGKMSRRTHLPIPTIAENIDLDQHYLVTRPQSDERRILHAIESLVIKWSHQIQEIIE
KDSAHPLLSGLHPTPETELDFWTMRHDNLKCIYSQLQAPIVLKMVKILRTRQSSYLPALK
GIFTTVENALLEAQDVELHLRPLRRHIHSLQEAEFPQTRILIAPLLHTICLIWSHSKFYN
TPARVIVLLQEFCNLFIDQARAYLSPEDLLKGEIEDALEKVQVAISVLKTFQNSFFKYRK
GLTSYFTRNTEQRSWDFQSHLVFGRFNKFLDRLVKIEDMFVTILEFEKLERLEFGGSKGA
VLNAQIHSTSEEFIECCKVFQQSTYDPSDCDDMEFESDYFKFKSRTLDFDRRLGTLLCEG
LSNCSGLESAFKLLTIFGNFLEKPVVMEMFSPHYSTLLNMFNAELDVCKQLYDEHMKQIE
HGHEILNKNMPFTSGNIKWARMLLERLQMFWSNFTSLHYLFPDSPDEAAVCQKYAEMTTL
LDQFESHIYSEWRRNVDETCEFNLNQPLVKFSPINGLLSVNFDPKLVAVLREVKYLLMLK
KSDIPDSALGIFQKRNIILKYIGNLELLVQGYNKLKQTLLEVEYPLIEDELGAIDEQLRV
AATWLTWQDDFWVYMERVQVATAELECRVSQTQSNMLTIQQTMQAWAEWPLLPRRETRRE
AALTLDDKGDLFAKKYKLIREDGCKIHNLVEENRKLFRADPSLDSWKIYVEFIDDIVVEG
FFQAILHDLDFFLRNTEKQLKPTPFFQAQMLLMPPEIVFKPPLEKEAGDGFYDLVEEMLC
GSFRVSAQMGRVAAHLDIADYQNDMDNMLGLAEVRQEIMNRVADVINKVLEFRSSLETYS
YLWVDDRVEILRQFLLYGHAVPSEEMDAPASEDILQPPTLEQFKEQIDIYEALYIQMSKF
DDFRVFNSWFKVDMRPFKLSLLNVIKKWSWMFQEHLLRFVVDSLSELQGFIKQTNAGLQR
QLCEGDHDGLVDIMGHLLAVRSRQRATDELFEPLKETIMLLESYGQKMPEQVYAQLEELP
ERWETTKKIAAMVRHEVSPLQNAEVTLIRKKCILFDEKQAEFRERFRSYAPLGFKAENPY
AVLDKANQELEALEEEMEQMQNSARLFEVALPEYKQMKQCRQEIRLLKGLWDVIIYVRRS
IDNWTETQWRQINVEQMDLELRRFAKEIWSLDKAVRVWDAYSGLEGTVKDMTTSLRAIAE
LQNPALRDRHWQQLMKAIGVRFSINDSTTLSDLLAVQLHRVEDDVRDIVDQAVKELGTEK
VITDVSHTWEALEFSYEAHHRTGTPLLKSDEQLFETLEHNQVQLQSLLQSKYVEYFIEQV
LSWQNKLNVADAVIFTWMQVQRTWSHLESIFVCSEDIRVQLVEDARRFDKVDAEFKELMF
ETAKVKNVLEATCRPHLYEKLKDFQHRLSLCEKALAEYLETKRVTFPRFYFISSADLLDI
LSKGAQPKQVTHHLVKLFDSISDLQFEDNLDVSTHKAVGMFSKEKEYVPFQAGCECIGHV
ESWLLQLEQTMKDTVRLAITEAITAYEEKPRELWIFDFPAQVALTGSQIWWTTDVGIAFS
RLEEGYETALKDFHKKQISQLNTLITLLLGELSPGDRQKVMTICTIDVHARDVVAKLISQ
KVVSPHAFTWLSQLRHEWEDSRKHCVVNICDAHFQYFYEYLGNSPRLVITPLTDRCYITL
TQSLHLTMSGAPAGPAGTGKTETTKDLGRALGMMVYVFNCSEQMDYRSIGNIYKGLVQTG
AWGCFDEFNRIAVEVLSVVAVQVKMIHDAIRNGRKRFVFLGETIPLKPSVGIFITLNPGY
AGRTELPENLKALFRPCAMVAPDTELICEIMLVAEGFVDARSLARKFISLYTLCEELLSK
QDHYDWGLRAIKSVLVVAGSLKRGDKNRPEDQVLMRALRDFNMPKIVTDDVPVFLGLVSD
LFPALDVPRQRKPHFEQMVKQSTLELRLQPEESFILKVVQLEELLAVRHSVFVVGNAGTG
KSKILRTLNRTYVNMKQKPVWSDLNPKAVTTDELFGFIHHATREWKDGLFSSILREQANL
THDGPTWIVLDGDIDPLWIESLNTVMDDNKVLTLASNERVALKPSMRLLFETHHLRTATP
ATVSRAGILYVNPQDLGWNPYVASWIDRRRHQSEKANLTILFDKYIPVCLEKLRTSFKAI
TSVPESSLVQTICTLLECLLTPENIPPDSPKETYEVYFAFACVWTFGGTLLRDQLSDYQA
DFSRWWHKEMKAVKFPSQGTIFDYYLDHKTKKFLPWTDKVPQFSMDADAPLKTVLVHTPE
TTRLRYFTELLLCKGKPIMLVGNAGVGKTVFLSNTLASLSENYIVSCVPFNYYTTSAALQ
RILEKPLEKKAGRNYGPKGNKKLVYFIDDLNMPEVDLYGTIQPHALLRQHIDYGHWYDRH
KIMLKEIRNCQYVACMNPMVGSFTVNPRLQRHFTVFAFNFPSLDALTTIYGQIFSFYLQQ
QAFCPSVLRAGPSLIQATIAFHQMMAESFVPTAIKFHYNFNLRDLSNIFQGILFASPECL
KSLEDLARLWLHETSRVYGDRLIDTNDFDLFQRKMLETAHKYFKGVDANALLRQPLVYCH
FASGGEDPCYMPVKDWEGLKAVLMEMVDNYNELHSAMHLVLFEDAMQHVCRISRILRIPQ
GHALLIGVGGSGKQSLSRLAAYICSLEVFQITLTEGYGAQELRVDLANLYVRTGAKNMPT
VFLLTDAHVLDESFLVLINDLLASGDIPDLFSDEDMDKIISGIRNEVRGLGLVDSRENCW
AFFLARVRQQLKMVFCFSPVGHTLRVRARKFPAIVNCTAIDWFHEWPQEALVSVSRRFIE
EIEGIEPQHKDSISLFMAHVHTSVKEVSAWYYQNERRYNYTTPRSFLEQISLFKSLLKKK
REEVKQKQEHLGNGIQKLQTTASQVGNLKSRLASQEAELQLRNLDAEALITKIGLQTEKV
SREKAIADAEERKVAAIQTEASQKQRECEADLLKAEPALVAAKDALNTLNRVNLTELKTF
PNPPNAVTNVTAAVMVLLAPRGRVPKDRSWKAAKIFMGKVDDFLQALINYDKEHIPENCL
KVVNEQYLKDPEFNPNLIRTKSFAAAGLCAWVINIIRFYEVYCDVEPKRQALAQTNLDLA
AATEKLEAVRRKLVDLDHNLSRLTASFEKATAEKVRCQEEVNQTNKTIDLANKLVSELES
EKIRWGQSIKSFETQEKTLCGDVLLTAAFVSYIGSFTRQYRQELVDCKWIPFLQQKVSIP
IAEGLDLIAMLTDDATIATWNNEGLPSDRMSTENATILTHCERWPLMIDPQQQGIKWIKN
KYGPDLKVTHLGQKGFLNTIETALAFGDVILIENLKETVDPVLGPLLGRNTTKKGKFIRI
GDKECEFNKNFRLILHTKLANPHYKPELQAQTTLLNFTVTEDGLEGQLLAEVVSIERPDL
ERLKLVLTKQQNDFKIELRQLEDDLLLRLSAAEGSFLDDTDLVERLETTKATAAEIEHKV
TEARENERKINETRECYRPVAARASLLYFVISDLRRINPVYQFSLKAFNTLFHRAIEQAD
KVEDTQERICALIESITHATFLYASQALFERDKLTFLSQMAFQILLRRNEIHPLELDFLL
RFTVEHTYSSPVDFLTAQSWSAVKAVALMEEFRGLDRDVEGSAKQWRKWVESECPEKEKL
PQEWKKKSLIQKLIILRAVRPDRMTYALRNFVEEKLGAKYVERTRLDLGKAFEESSPSTP
VFFILSPGVDALKDLEVLGKRLGFTIDSGKFHNVSLGQGQELVAEMAMEKAAAGGHWVIL
QNVHLVAKWLGTLEKLLEKFSQGSHRDYRVFLSAETVPSQHEPIIPQGLLENSIKITNEP
PTGMLANLHAALYNFDQDTLEMCSKDQEFKSILFSLCYFHACVAGRLRFGPQGWSRSYPF
SPGDLTICTNILYNYLEANPNVPWEDLRYLFGEIMYGGHITDAWDRKLCRVYLEEFMNPS
LIEDEVMLAPGFAAPPYSDYSGYHQYIEDTLPPESPALYGLHPNAEIELLTVTSNTLFRT
LLEMQPRNAVSQEELGQSTEDKVKNILDDILERLPEEFNMAEIMQKNPNRSPYVLVCFQE
CERMNVLIREIRVSLQHLDLGLKGELTLSPDVETQLSALSYDRVPDTWNKLAYPSTYGLA
QWFNDLLLRCRELDTWTQDLTLPAVVWLSGFFNPQSFLTAIMQTMARKNEWPLDRMCLTI
DVTKKTKEDYGHPPREGAYLHGLHLEGARWDIQSGALVDARLKELTSMMPVIFAKAVPVD
RQEIKHAYECPVYKTKARGPTYVWTFRLRSKDRIAKWVLAGVALLLEA
NT seq 13467 nt NT seq  +upstreamnt  +downstreamnt
atggcagcacaggaggaagggactgtgctgaggctcagcccctcagagcaggaggacgag
gaggacgaggaggcggcggctgcaaggagagtgcaacgctttgccctagacccgcgggtg
cgcttcctgggaggccgtctgcgccaggcgttgaggttcccggaggagacgtggggccag
tatctggagagcgatgaccaccggcaggtcctaggagactttttggagagcactggtcct
gccagcctggtgtttagtgttgcgaccgccgggcggctctcggcttcccccgagattcca
agagatgtgaaacacaagctggtttattttgccaagaagatgactgaaaacatgggagaa
agtgatttctcccaaaccattttatttggagaaatacccaggtcattgcttacacatgta
actgcattcctagatgagatattagtcccagttctgtctaataagaacaaccatacgtcc
tggtcatgctttatctcacaagatgtggaacatcacacagaagtcatgaaaaataagatg
cacatttttaggggcaaaatgtcaagaagaactcatctgccaattcctactattgcagaa
aatattgacttggatcagcattacttggtgaccaggccacaatcagatgagagaagaata
ctccatgccattgaatctttagtcattaaatggtcacatcagatccaagaaatcatagaa
aaagattcagcacaccctctcttgagtggtctccatccgacccctgagacagagctggac
ttctggaccatgaggcatgataacttgaaatgcatatactctcaacttcaggctccaatt
gtcctcaagatggttaagatactgagaacaagacaaagcagctatcttcctgctctgaag
ggcatctttaccacggtagaaaatgctcttcttgaagcccaggatgtggaacttcaccta
agacctctgaggaggcacattcacagtctccaggaggcagaattcccacagactagaata
ctgattgccccattgcttcacaccatctgtcttatctggagtcattccaagttttataac
acccctgctcgggttatagttttactgcaagagttttgtaacctcttcattgaccaggca
agagcatacctgtcacctgaagatcttctgaaaggagaaattgaagacgcactggaaaag
gtgcaggtggccatcagtgtcttaaagacgttccagaattctttcttcaaatatagaaag
ggattgacaagctatttcacaagaaacacggagcagagatcctgggattttcagtctcat
ctggtgtttggcagatttaacaaatttcttgaccggctggtaaaaatagaggatatgttt
gtcaccatactggaatttgagaaactggaaagactggaatttggtggcagcaagggagcc
gtcctaaatgcacaaatccactcaacaagtgaggaatttatcgaatgctgcaaagttttc
caacagagcacgtacgatccgtctgactgtgatgacatggagttcgaaagtgattatttc
aaatttaagtccagaaccctggattttgacagaaggcttgggacgctgctttgcgaaggt
ctcagcaactgcagtggtttggagtctgcatttaagcttttgaccatatttgggaacttt
ctagagaaaccagttgtcatggaaatgttcagcccacattacagcacattattgaacatg
tttaatgcagagttggatgtgtgtaagcaactgtatgatgaacacatgaagcagattgaa
cacgggcatgaaattctgaacaagaatatgccattcacctctggaaatattaagtgggcc
agaatgctccttgaacgccttcaaatgttctggtcaaactttacatctcttcattatcta
tttccagacagtcctgatgaggctgcagtctgtcagaagtatgctgaaatgaccactttg
ctggatcaatttgaaagtcacatctatagtgaatggagaagaaatgtggacgaaacctgt
gaatttaatctgaatcaacccttggttaaattcagtcccataaacggccttcttagtgtc
aactttgacccaaagcttgtggcggtgctgagagaagtcaaataccttttgatgctgaag
aagtccgacataccagattcagctttaggcattttccagaaaaggaacattattttaaag
tacattgggaatcttgagctccttgtacaaggctacaataagctgaaacagacccttctg
gaagtggaataccctctcattgaggatgagcttggagccattgatgagcagctcagggtg
gctgcaacctggctgacatggcaagatgacttctgggtctacatggagagggtgcaggtg
gccactgctgagctagagtgcagagtgtcacagactcagagcaacatgctaacaatccag
caaaccatgcaggcctgggctgagtggccactgctgccccggagggagaccagaagagag
gctgccttgaccttggacgacaagggggatctgtttgcaaaaaagtacaagctgatccga
gaagatggttgcaagatacacaacttggtagaggagaaccggaagctcttcagagctgat
ccttccctggattcctggaaaatttatgtggaattcattgatgacattgtggtggaaggc
ttttttcaggccatcttgcatgacctggacttcttcctgaggaacacagagaaacagtta
aaacccacaccattttttcaagcacaaatgctcttaatgcccccagagattgtgttcaag
cctcctttagaaaaagaggctggggatggcttctacgatctggtggaggaaatgttgtgt
ggcagcttcagagtgtctgcccagatggggcgcgtggcagcacacctggacatcgcagac
taccagaacgatatggataacatgttaggcctggcggaggtccggcaggagatcatgaat
agagttgctgatgtcatcaacaaagtcttagagttcagaagttctctggagacctactct
tacctctgggtggatgaccgggtagagattctaaggcagtttctcctgtacggccatgct
gtgccatctgaggaaatggatgctcctgcaagtgaagacatcctgcaaccaccaacacta
gaacaattcaaagaacagattgacatttacgaggctttgtatattcagatgagcaagttt
gacgacttccgagtatttaacagttggttcaaggtagacatgagaccttttaagttgagc
ttgctcaacgtgatcaagaagtggagttggatgtttcaagagcatctgctaagatttgtc
gtcgacagtctgagtgagctgcaaggattcatcaagcagacaaatgcaggacttcagaga
cagctgtgtgagggcgatcatgatggcttagttgacatcatgggtcaccttctggctgta
agaagccgacagagagctactgatgagctctttgaacctctgaaagaaacaatcatgctt
ctggaaagctatgggcagaaaatgcccgagcaagtctatgcccagctggaggaattacct
gaaagatgggaaaccaccaagaagattgcagccatggtcagacatgaggtctcgccactc
caaaacgcagaggttactcttatacggaaaaaatgtattttgtttgatgaaaagcaagca
gaattcagagagagattcagaagctatgctcctcttggatttaaggcagagaatccatac
gcagtgcttgataaggcaaatcaggagctcgaggctctagaggaagagatggagcagatg
caaaactctgcacgtctttttgaggtggctcttccggagtacaaacaaatgaagcagtgc
cgacaagaaatccgcctgctcaaagggctctgggatgtcattatttatgttaggagaagc
attgataattggaccgaaacccagtggagacagattaacgtggaacagatggacttggag
ctcagaaggtttgccaaggaaatttggtcactggacaaggctgtccgcgtctgggatgct
tattcaggcctggaaggcactgtgaaggatatgacaacctccctaagagccattgcagag
ctgcagaaccctgccctcagagacaggcattggcagcagctgatgaaggccattggggtc
agattctcaataaatgacagcacaacgctgtcagacttgctggcagtgcagctgcaccga
gtagaagatgacgtgagagacattgtggatcaggccgtgaaggagctaggcacagagaag
gttatcactgatgtcagccacacctgggaagccctggaattttcttatgaggctcaccat
agaacaggcaccccactgctgaagtctgatgaacagctttttgagactctagagcacaac
caggttcagttgcagagtcttcttcagagcaagtacgtggaatacttcattgaacaagtc
ctaagctggcaaaacaagctaaatgtagccgatgcagttatctttacttggatgcaagtc
cagcgaacctggtctcacctggaaagcatcttcgtttgttcagaagatattcgggtccag
cttgtggaagatgccagaagatttgataaagtagatgccgaatttaaggagttaatgttc
gagacagccaaagtaaagaatgtcttagaagcaacatgcagaccccacctctatgagaaa
cttaaagattttcagcacaggctctctctttgtgaaaaagccctggctgaatacctggaa
accaagcgggtcacattccctcgcttctacttcatctcctctgcagacttgctggacatt
ctctccaagggagcacagccgaagcaggtaacacaccaccttgtcaaactctttgacagc
atctcggatctgcagttcgaagataatctggacgtgtccacacacaaagcagttggaatg
ttcagcaaagaaaaggagtatgtcccattccaggccggatgtgaatgcataggccatgtg
gaaagctggcttctgcaactcgaacagaccatgaaggacacagtgcgtctggcaatcaca
gaagccatcacagcctatgaggagaaacctagagagctctggatctttgatttcccagct
caggtggctctaactggatcacaaatatggtggaccacagacgtaggaattgccttcagt
cgactagaggagggctatgaaacagccttgaaggatttccataagaaacagatttcacag
ctgaatacactgatcacacttcttctgggagaactttcgcctggagacaggcagaaggtc
atgaccatctgcaccattgatgtccatgccagagatgtggtggcaaaattgatttctcag
aaggttgtcagcccccatgcttttacctggctgtctcaactccgacacgagtgggaggat
tcaaggaaacactgcgttgttaatatttgtgacgcccacttccagtacttctacgaatac
ttgggaaacagtccacggctggtgatcactcctctcactgacaggtgttacatcacttta
actcaatcacttcatctgaccatgagcggcgctccggctggcccagctggaacagggaaa
acggaaaccaccaaagaccttggccgtgccctgggcatgatggtttacgtattcaactgc
tcagagcaaatggactacaggtccataggaaacatctataaaggactggtgcagacggga
gcatggggctgctttgatgagttcaaccgcatcgctgtggaggttctgtctgtagtggca
gtgcaggtgaagatgattcatgacgccatcaggaacgggagaaagagatttgtatttctt
ggagagactatcccgctgaaaccctcggttggaatatttattactctgaacccaggatat
gccggtcgaaccgaattaccagaaaacctcaaagctctgttcagaccctgtgccatggtg
gccccggacactgagctgatctgtgaaatcatgttggtggcggaagggtttgtggatgca
cgctcgttggcccggaagttcatttccttgtacacgctctgtgaggagctgctgtccaag
caggatcactatgactggggacttcgtgctattaagtctgtcttggtggtagctggctca
ctgaaacgaggagataaaaatagacccgaagatcaggtgctcatgagagcattgagggac
tttaatatgcctaaaattgtaactgatgatgtcccagtgttcctgggcctggttagcgac
ctgtttccagccctggatgtacctcggcagaggaaaccacactttgaacagatggtcaag
cagtctaccctggaacttcgcctgcagcccgaggagagcttcatcctcaaagttgtccag
cttgaggagctactggccgtgcgacactctgtctttgtggttggaaatgcaggcacagga
aagagtaagattttgagaacactgaacagaacatatgttaacatgaaacagaagcctgtt
tggagtgacttaaaccccaaggctgtgacaacagatgaactctttggtttcatacatcat
gctacccgagaatggaaagatggtctcttctcatccattctgagagagcaggcaaatctc
acacatgatgggccaacctggatagtcctggatggggatattgaccccctgtggatcgag
tccctgaacacagtgatggatgataacaaggtgctgaccctggccagcaatgaacgagtg
gccctcaaaccttccatgaggcttctattcgagacccatcacctgcggacagccacacca
gccacggtctccagagctggcattttgtatgtgaacccgcaggatctgggctggaatccg
tatgtggccagttggatagacagaagacggcatcaatcagaaaaggccaatttaactatt
ctttttgataaatacattcctgtgtgcttggagaagctaagaacgagctttaaagccatc
acttcggttccagagagcagcctggtgcagactatttgtactcttttggagtgtttgttg
actcccgagaacatacctcctgacagtcctaaagagacctatgaagtctattttgccttt
gcttgtgtctggacatttggaggcaccctactacgggatcagctttctgattatcaagcc
gacttcagtagatggtggcataaggaaatgaaagcagtgaagtttccatcccagggaacc
atctttgattattatctggaccacaaaactaaaaaatttttgccttggactgacaaggtt
ccccagttctccatggatgctgatgcgcccctgaagacagttctggtacacacaccagag
acaactcgtctgaggtattttactgagttgctactttgcaaaggcaaaccgataatgctg
gttggaaatgcaggagtggggaaaacggtctttttgagcaacaccctggcaagtctctct
gagaactacatagtatcctgtgtgcctttcaactactacacaacatcagcagccctgcag
agaattcttgaaaaacctctagagaaaaaagctggtcgtaactatggtccaaaaggaaat
aaaaaactggtttatttcattgatgatctgaacatgcctgaagtggatttgtatggcact
atccagcctcatgcgctgcttcggcagcatattgactatgggcactggtacgatcgacat
aaaattatgctcaaggaaatccgcaactgccagtacgtagcctgcatgaatcccatggtg
ggcagcttcacagtcaacccaaggctgcagagacatttcactgtgtttgcattcaacttt
ccatctttggatgcgctgaccaccatctatggtcagatcttcagcttctatctccagcaa
caagcattctgcccatcagttctcagggctggcccctctttgatccaggcaacaatcgca
tttcatcagatgatggcagagagctttgtgcctacagctattaaattccattacaatttt
aatctaagagacttatcaaacatcttccaggggattttatttgcttctcctgagtgttta
aaatccctggaagacttagcacgcctgtggcttcatgaaacgtcacgtgtttatggagac
agactgatagacacaaacgattttgacttatttcagaggaaaatgctggaaactgcccat
aagtactttaaaggtgtagatgctaatgcgctgctgcggcagccccttgtctattgtcac
tttgccagtggaggggaagacccttgttacatgccagtgaaggactgggaagggctaaag
gcagttcttatggagatggtagacaactacaacgaactccactcagcgatgcacctggtg
ctatttgaagacgccatgcaacacgtgtgtagaatcagccgcatccttcggatccctcaa
ggccacgccctcttgattggcgttggaggcagtggcaagcagagcctgtcccggctggca
gcttacatctgcagcttggaggtctttcagatcactctgacggaaggctatggggcccaa
gagcttcgggtagatctggccaatttgtacgtcagaactggagccaaaaacatgcccacc
gtgttcctgctgacagatgcccacgttctagatgagagcttcctcgtgctgattaacgac
ttgctggcatcgggagacatcccagatctgttcagtgatgaagatatggacaagatcatt
tccgggattcgtaatgaagttcgaggcctcggcttagtggactccagggaaaactgttgg
gcattctttttggccagagtccgacaacagctcaaaatggttttttgtttctcaccggtt
ggccacacactgcgagttagagcccggaagttcccagccatagttaactgcacagctatt
gactggtttcatgaatggccacaggaggctctggtctcagtcagcaggaggttcatcgaa
gaaattgaggggattgagccacagcacaaagattctatcagccttttcatggctcatgtt
cacaccagtgtaaaggaagtgagtgcctggtactaccagaacgagagaagatacaactat
accacccccaggagtttcttagaacaaatatcactgtttaagagcctgctgaagaagaag
cgagaagaggtaaaacagaagcaggagcacctggggaatggaatccagaagctgcagact
acagcctcacaggtgggaaatctgaagtccaggctagcctctcaagaggctgagttgcag
ctcagaaacctcgatgccgaggccctgatcacaaagattgggcttcagacggagaaagtg
agccgggaaaaggccatcgcggacgcggaggagcgaaaggtggctgccattcaaactgaa
gcatcccagaagcagagagagtgtgaagctgacttactcaaggctgagcctgccctggtg
gctgctaaggatgcactcaatacactcaacagggtgaacctcacagaactgaaaacgttc
cccaaccccccaaatgctgttaccaatgtaaccgcagctgtgatggtcctactggccccc
cgaggcagagtgccaaaagaccgaagttggaaagcagctaaaatcttcatggggaaggtt
gatgacttcctacaagcgttaattaactacgataaagagcacattccagagaactgtcta
aaagtagtcaatgaacaatatttgaaagatccagagtttaatccaaacctgattcggacc
aaatcttttgcagcggctggtctctgtgcctgggtcatcaacatcattagattttatgag
gtttattgtgatgtggagcccaaacgccaggcattggcccaaacaaacttggacctggct
gcagctactgaaaagctagaggctgtaaggaggaaacttgtggatctggatcataatctg
agcagacttacagcttcatttgaaaaggcaacagctgagaaggtccggtgtcaggaagaa
gtgaatcaaaccaataagacgatcgacctagccaacaaacttgtcagtgaacttgagtca
gagaagattcgatggggtcagtccattaagtcctttgaaactcaagagaagacactgtgt
ggagatgtgctcctcacggcggcatttgtgtcttacattgggtccttcacaagacagtat
cgccaggaactggtggactgcaagtggattccatttcttcagcagaaggtttccatccca
atagcagaagggctggacttgattgccatgttgacagacgatgctacaattgccacctgg
aataacgaagggctacccagcgacaggatgtcaactgaaaatgccaccattctaactcac
tgcgagcgctggcccctgatgatcgatccccagcaacagggaattaagtggatcaagaat
aagtatgggcctgacctgaaagtcacacacttaggccagaaagggtttttaaacaccatt
gagacagccctggccttcggtgatgtcatcctaattgaaaacctcaaggagacagtggat
ccagtcctgggtcctctgctcggcaggaacaccactaagaaaggaaagttcatcaggatt
ggcgataaagaatgcgaattcaacaagaacttccgcctcatcctacacacaaaactggca
aacccacactacaagccggaactacaagcccaaaccacccttctcaatttcacagtcaca
gaagatggtcttgaaggccagctgctggcagaggtggtcagtatcgaaaggccagatttg
gagaggctaaagctggttttgaccaagcagcaaaatgactttaagatagagctgaggcag
cttgaagacgaccttctcctgcgcctctctgctgctgaggggagcttcctggatgacaca
gacctggtagagcgcctcgagacgaccaaggccactgcagcagaaatagagcacaaggtg
acagaagccagagaaaatgaaagaaaaatcaatgagacccgtgagtgctacagaccagtg
gcagcgagagcatcccttctgtactttgtcatcagtgacctcaggagaatcaaccccgtc
taccagttctctctgaaggctttcaacacactgttccacagagccattgagcaagctgac
aaggtggaggatactcaggagcgcatctgtgccctaatagagagcatcacccacgccacc
ttcctctatgccagccaagcactgtttgagagggacaagctcacatttctgtcccagatg
gcctttcagatcttgttgagaaggaacgagatccaccccctcgagttggatttcctgctt
cggttcacagttgagcatacttactcgagccctgtggattttctaactgctcagtcatgg
agtgctgttaaggcagtcgccctcatggaggaattccgaggcttagacagagatgtggaa
ggatctgccaagcagtggaggaaatgggtagaatcagagtgtcctgaaaaagaaaagtta
ccgcaagaatggaagaagaaaagtttaatacagaaactgattattttgagagccgtgcgg
cctgacaggatgacgtatgccctgaggaatttcgtagaagagaaactaggagcaaagtat
gtggagaggactagattggacctgggcaaagcatttgaagaaagcagcccgagcaccccg
gtgttcttcatcctgtctccaggtgtggatgcccttaaagacttagaggtgctcggcaaa
aggctggggtttacgattgactctggaaaattccacaatgtgtctctagggcaaggtcag
gaactagtggcggaaatggcaatggagaaagctgccgctggaggacactgggtcatcctt
cagaatgttcatctggtagccaaatggctgggaactctggagaaactccttgaaaaattc
agtcaaggaagccacagagattacagggtgttcctgagtgctgagactgtaccttcccaa
catgagcccataatccctcaaggcctcctggaaaattccattaagatcactaacgagccc
cccacgggaatgctggccaacctacatgctgctttgtacaactttgaccaggatacactt
gagatgtgttccaaagatcaggagtttaaaagcatcctcttctctctgtgctacttccat
gcctgtgtggcagggagactgaggttcggtccccagggctggagccgaagctatcctttc
agtcctggagacctgactatctgcaccaacatcctctacaactacttagaggcaaacccg
aacgtcccatgggaagacctccgttacctctttggggagatcatgtatgggggccacatc
acagatgcctgggatcgaaaactatgccgggtgtatctagaagaattcatgaatccatct
ctgatcgaggatgaagtcatgctggcaccaggatttgcagcccctccctactcagattat
tctggttatcaccagtacatagaggacacgttgcctccagaaagcccggcactgtatggt
ctccaccccaatgctgaaatagagttactaacagtgacatccaacacgctcttcagaact
ctgctggagatgcaacccaggaatgcagtcagccaagaggaactggggcagtctacagaa
gacaaggttaagaatatcttggatgacattttggagagacttccagaagagttcaacatg
gcagaaataatgcaaaagaacccaaatagaagcccgtatgttctcgtttgctttcaagag
tgtgagaggatgaacgttctcatccgggaaatccgtgtgtcgcttcaacacttagacctt
ggtttgaagggagagttgacattatctcctgatgtggaaacccagctgtccgccctgagt
tatgaccgggttccagatacatggaacaaactggcatatccatctacttatggcctggcc
cagtggtttaacgacctcctcttacgctgccgggaacttgatacttggactcaagacctc
accctcccagctgttgtgtggctttctgggttcttcaaccctcaatctttcttaacagca
atcatgcagaccatggctcgaaaaaacgagtggccactggacagaatgtgtttgactata
gatgttactaaaaaaaccaaggaagactatggccacccccccagagaaggtgcatacctt
catggcctccacctggaaggtgccaggtgggacatccagtcaggagcccttgttgatgcc
cgccttaaggagttaacgtccatgatgcccgtcatctttgccaaagccgtgcccgtggac
agacaagaaattaagcatgcctacgagtgccctgtttacaaaaccaaagcgagaggcccc
acctacgtgtggacgttcaggctaaggagcaaagacaggatagctaagtgggtactggca
ggtgtggctctactgctggaagcatga

DBGET integrated database retrieval system