KEGG   Mus musculus (mouse): 13424Help
Entry
13424             CDS       T01002                                 

Gene name
Dync1h1, 9930018I23Rik, AI894280, DHC1, DHC1a, DNCL, Dnchc1, Dnec1, Dnecl, Loa, MAP1C, P22, Swl, mKIAA0325
Definition
(RefSeq) dynein cytoplasmic 1 heavy chain 1
  KO
K10413  dynein heavy chain 1, cytosolic
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04145  Phagosome
mmu04962  Vasopressin-regulated water reabsorption
mmu05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    13424 (Dync1h1)
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    13424 (Dync1h1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    13424 (Dync1h1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    13424 (Dync1h1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    13424 (Dync1h1)
   04147 Exosome [BR:mmu04147]
    13424 (Dync1h1)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Motor proteins
     Dynein complex
      13424 (Dync1h1)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     13424 (Dync1h1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   13424 (Dync1h1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHC_N1 AAA_6 DHC_N2 AAA_9 AAA_8 Dynein_C AAA_7 AAA_lid_11 MT Dynein_heavy AAA_5 Dynein_AAA_lid AAA AAA_22 AAA_33 AAA_18 Mg_chelatase IstB_IS21 T2SSE AAA_lid_1 AAA_19 AAA_25
Motif
Other DBs
NCBI-GeneID: 13424
NCBI-ProteinID: NP_084514
MGI: 103147
Ensembl: ENSMUSG00000018707
Vega: OTTMUSG00000036080
UniProt: Q9JHU4
Structure
PDB: 

Position
12 F1; 12 60.7 cM
AA seq 4644 aa AA seqDB search
MSEPGGGEDGSAGLEVSAVQNVADVAVLQKHLRKLVPLLLEDGGDAPAALEAALEEKSAL
EQMRKFLSDPQVHTVLVERSTLKEDVGDEGEEEKEFISYNINIDIHYGVKSNSLAFIKRA
PVIDADKPVSSQLRVLTLSEDSPYETLHSFISNAVAPFFKSYIRESGKADRDGDKMAPSV
EKKIAELEMGLLHLQQNIEIPEISLPIHPIITNVAKQCYERGEKPKVTDFGDKVEDPTFL
NQLQSGVNRWIREIQKVTKLDRDPASGTALQEISFWLNLERALYRIQEKRESPEVLLTLD
ILKHGKRFHATVSFDTDTGLKQALETVNDYNPLMKDFPLNDLLSATELDKIRQALVAIFT
HLRKIRNTKYPIQRALRLVEAISRDLSSQLLKVLGTRKLMHVAYEEFEKVMVACFEVFQT
WDDEYEKLQVLLRDIVKRKREENLKMVWRINPAHRKLQARLDQMRKFRRQHEQLRAVIVR
VLRPQVTAVAQQNQGEAPEPQDMKVAEVLFDAADANAIEEVNLAYENVKEVDGLDVSKEG
TEAWEAAMKRYDERIDRVETRITARLRDQLGTAKNANEMFRIFSRFNALFVRPHIRGAIR
EYQTQLIQRVKDDIESLHDKFKVQYPQSQACKMSHVRDLPPVSGSIIWAKQIDRQLTAYM
KRVEDVLGKGWENHVEGQKLKQDGDSFRMKLNTQEIFDDWARKVQQRNLGVSGRIFTIES
ARVRGRTGNVLKLKVNFLPEIITLSKEVRNLKWLGFRVPLAIVNKAHQANQLYPFAISLI
ESVRTYERTCEKVEERNTISLLVAGLKKEVQALIAEGIALVWESYKLDPYVQRLAETVFN
FQEKVDDLLIIEEKIDLEVRSLETCMYDHKTFSEILNRVQKAVDDLNLHSYSNLPIWVNK
LDMEIERILGVRLQAGLRAWTQVLLGQAEDKAEVDMDTDAPQVSHKPGGEPKIKNVVHEL
RITNQVIYLNPPIEECRYKLYQEMFAWKMVVLSLPRIQSQRYQVGVHYELTEEEKFYRNA
LTRMPDGPVALEESYSAVMGIVTEVEQYVKVWLQYQCLWDMQAENIYNRLGEDLNKWQAL
LVQIRKARGTFDNAETKKEFGPVVIDYGKVQSKVNLKYDSWHKEVLSKFGQMLGSNMTEF
HSQISKSRQELEQHSVDTASTSDAVTFITYVQSLKRKIKQFEKQVELYRNGQRLLEKQRF
QFPPSWLYIDNIEGEWGAFNDIMRRKDSAIQQQVANLQMKIVQEDRAVESRTTDLLTDWE
KTKPVTGNLRPEEALQALTIYEGKFGRLKDDREKCAKAKEALELTDTGLLSGSEERVQVA
LEELQDLKGVWSELSKVWEQIDQMKEQPWVSVQPRKLRQNLDGLLNQLKNFPARLRQYAS
YEFVQRLLKGYMKINMLVIELKSEALKDRHWKQLMKRLHVNWVVSELTLGQIWDVDLQKN
EAVVKDVLLVAQGEMALEEFLKQIREVWNTYELDLVNYQNKCRLIRGWDDLFNKVKEHIN
SVSAMKLSPYYKVFEEDALSWEDKLNRIMALFDVWIDVQRRWVYLEGIFTGSADIKHLLP
VETQRFQSISTEFLALMKKVSKSPLVMDVLNIQGVQRSLERLADLLGKIQKALGEYLERE
RSSFPRFYFVGDEDLLEIIGNSKNVAKLQKHFKKMFAGVSSIILNEDNSVVLGISSREGE
EVMFKTPVSITEHPKINEWLTLVEKEMRVTLAKLLAESVTEVEIFGKATSIDPNTYITWI
DKYQAQLVVLSAQIAWSENVENALSNVGGGGDVGPLQSVLSNVEVTLNVLADSVLMEQPP
LRRRKLEHLITELVHQRDVTRSLIKSKIDNAKSFEWLSQMRFYFDPKQTDVLQQLSIQMA
NAKFNYGFEYLGVQDKLVQTPLTDRCYLTMTQALEARLGGSPFGPAGTGKTESVKALGHQ
LGRFVLVFNCDETFDFQAMGRIFVGLCQVGAWGCFDEFNRLEERMLSAVSQQVQCIQEAL
REHSNPNYDKTSAPITCELLNKQVKVSPDMAIFITMNPGYAGRSNLPDNLKKLFRSLAMT
KPDRQLIAQVMLYSQGFRTAEVLANKIVPFFKLCDEQLSSQSHYDFGLRALKSVLVSAGN
VKRERIQKIKREKEERGEAVDEGEIAENLPEQEILIQSVCETMVPKLVAEDIPLLFSLLS
DVFPGVQYHRGEMTALREELKKVCQEMYLTYGDGEEVGGMWVEKVLQLYQITQINHGLMM
VGPSGSGKSMAWRVLLKALERLEGVEGVAHIIDPKAISKDHLYGTLDPNTREWTDGLFTH
VLRKIIDNVRGELQKRQWIVFDGDVDPEWVENLNSVLDDNKLLTLPNGERLSLPPNVRIM
FEVQDLKYATLATVSRCGMVWFSEDVLSTDMIFNNFLARLRSIPLDEGEDEAQRRRKGKE
DEGEEAASPMLQIQRDAATIMQPYFTSNGLVTKALEHAFKLEHIMDLTRLRCLGSLFSML
HQACRNVAQYNANHPDFPMQIEQLERYIQRYLVYAILWSLSGDSRLKMRAELGEYIRRIT
TVPLPTAPNVPIIDYEVSISGEWSPWQAKVPQIEVETHKVAAPDVVVPTLDTVRHEALLY
TWLAEHKPLVLCGPPGSGKTMTLFSALRALPDMEVVGLNFSSATTPELLLKTFDHYCEYR
RTPNGVVLAPVQLGKWLVLFCDEINLPDMDKYGTQRVISFIRQMVEHGGFYRTSDQTWVK
LERIQFVGACNPPTDPGRKPLSHRFLRHVPVVYVDYPGPASLTQIYGTFNRAMLRLIPSL
RTYAEPLTAAMVEFYTMSQERFTQDTQPHYIYSPREMTRWVRGIFEALRPLETLPVEGLI
RIWAHEALRLFQDRLVEDEERRWTDENIDMVALKHFPNIDKEKAMSRPILYSNWLSKDYI
PVDQEELRDYVKARLKVFYEEELDVPLVLFNEVLDHVLRIDRIFRQPQGHLLLIGVSGAG
KTTLSRFVAWMNGLSVYQIKVHRKYTGEDFDEDLRTVLRRSGCKNEKIAFIMDESNVLDS
GFLERMNTLLANGEVPGLFEGDEYATLMTQCKEGAQKEGLMLDSHEELYKWFTSQVIRNL
HVVFTMNPSSEGLKDRAATSPALFNRCVLNWFGDWSTEALYQVGKEFTSKMDLEKPNYIV
PDYMPVVYDKLPQPPTHREAIVNSCVFVHQTLHQANARLAKRGGRTMAITPRHYLDFINH
YANLFHEKRSELEEQQMHLNVGLRKIKETVDQVEELRRDLRIKSQELEVKNAAANDKLKK
MVKDQQEAEKKKVMSQEIQEQLHKQQEVIADKQMSVKEDLDKVEPAVIEAQNAVKSIKKQ
HLVEVRSMANPPAAVKLALESICLLLGESTTDWKQIRSIIMRENFIPTIVNFSAEEISDA
IREKMKKNYMSNPSYNYEIVNRASLACGPMVKWAIAQLNYADMLKRVEPLRNELQKLEDD
AKDNQQKANEVEQMIRDLEASIARYKEEYAVLISEAQAIKADLAAVEAKVNRSTALLKSL
SAERERWEKTSETFKNQMSTIAGDCLLSAAFIAYAGYFDQQMRQNLFTTWSHHLQQANIQ
FRTDIARTEYLSNADERLRWQASSLPADDLCTENAIMLKRFNRYPLIIDPSGQATEFIMN
EYKDRKITRTSFLDDAFRKNLESALRFGNPLLVQDVESYDPVLNPVLNREVRRTGGRVLI
TLGDQDIDLSPSFVIFLSTRDPTVEFPPDLCSRVTFVNFTVTRSSLQSQCLNEVLKAERP
DVDEKRSDLLKLQGEFQLRLRQLEKSLLQALNEVKGRILDDDTIITTLENLKREAAEVTR
KVEETDIVMQEVETVSQQYLPLSTACSSIYFTMESLKQVHFLYQYSLQFFLDIYHNVLYE
NPNLKGATDHTQRLSIITKDLFQVAFNRVARGMLHQDHITFAMLLARIKLKGTVGEPTYD
AEFQHFLRGKEIVLSAGSTPKIQGLTVEQAEAVVRLSCLPAFKDLIAKVQADEQFGIWLD
SSSPEQTVPYLWSEETPTTPIGQAIHRLLLIQAFRPDRLLAMAHMFVSTNLGESFMSIME
QPLDLTHIVGTEVKPNTPVLMCSVPGYDASGHVEDLAAEQNTQITSIAIGSAEGFNQADK
AINTAVKSGRWVMLKNVHLAPGWLMQLEKKLHSLQPHACFRLFLTMEINPKVPVNLLRAG
RIFVFEPPPGVKANMLRTFSSIPVSRICKSPNERARLYFLLAWFHAIIQERLRYAPLGWS
KKYEFGESDLRSACDTVDTWLDDTAKGRQNISPDKIPWSALKTLMAQSIYGGRVDNEFDQ
RLLNTFLERLFTTRSFDSEFKLACKVDGHKDIQMPDGIRREEFVQWVELLPDAQTPSWLG
LPNNAERVLLTTQGVDMISKMLKMQMLEDEDDLAYAETEKKARTDSTSDGRPAWMRTLHT
TASNWLHLIPQTLSPLKRTVENIKDPLFRFFEREVKMGAKLLQDVRQDLADVVQVCEGKK
KQTNYLRTLINELVKGILPRSWSHYTVPAGMTVIQWVSDFSERIKQLQNISQAAASGGAK
ELKNIHVCLGGLFVPEAYITATRQYVAQANSWSLEELCLEVNVTASQSATLDACSFGVTG
LKLQGATCSNNKLSLSNAISTVLPLTQLRWVKQTSAEKKASVVTLPVYLNFTRADLIFTV
DFEIATKEDPRSFYERGVAVLCTE
NT seq 13935 nt NT seq  +upstreamnt  +downstreamnt
atgtcggagccgggcggcggcgaggacggctcggccggcctggaggtgtcggcggtgcag
aatgtggcggacgtggcggtgctgcagaagcacctgcgtaagctggtgccgctgctgctg
gaggacggcggcgacgcgccggctgcgctggaggcggcgctggaggagaagagcgccctg
gagcagatgcgcaagttcctgtcagacccgcaggtccacacggtcctggtggagcgctcc
accctcaaagaggatgttggtgatgaaggagaagaggagaaagaattcatttcctataac
atcaacatagacattcattacggggtaaagtccaacagcttggcgttcatcaagcgagct
cctgtgattgatgcagacaagccagtgtcgtcccagctccgagtcctcactctgagtgaa
gactcgccgtatgagacactgcactctttcatcagcaatgcagtggctcctttctttaag
tcctacatcagagagtctggcaaagcagacagggatggtgataagatggctccttcagtt
gaaaaaaagattgcagagcttgaaatgggactcctccacctgcagcagaacattgagatc
ccagagatcagcttgccaattcatcccatcatcacgaacgttgcgaagcagtgctatgag
cgcggagaaaagcccaaagttacagactttggtgataaggttgaagacccaactttcctt
aaccaattacagtctggagttaatcggtggatccgagaaattcaaaaggtgaccaagctt
gaccgggatccagcatcaggaactgccttgcaggaaatcagcttttggctaaacttggaa
cgtgcgttgtaccgcatccaagagaagcgggagagccccgaggtgctcctgactctggac
atcctgaagcacggcaaacgtttccatgccactgtcagttttgacactgatacaggtctg
aagcaggcgttggaaacggtgaatgactacaaccctctgatgaaagacttccctctgaat
gacttgctgtctgccacggagctggacaagataaggcaggcccttgttgcaattttcaca
catctgagaaagatccgcaacacgaagtacccgattcagcgggccctgcgtctcgtggag
gccatctccagagacctgagttctcagctgctcaaggtcttgggcactcggaagttgatg
catgtagcctatgaagagtttgaaaaggtcatggtggcttgcttcgaagtcttccagacg
tgggacgacgagtacgagaagctccaggtgctgctgcgagacatcgtcaagaggaagcgg
gaggagaacctgaagatggtgtggcgcatcaaccccgctcacaggaagcttcaggcccgc
ctcgaccagatgaggaagttccgccgccagcacgagcagctgagggctgtcattgtcagg
gtcctgaggccacaggtcacagcagtcgcacaacagaaccaaggagaagcacctgaaccc
caagacatgaaagtggccgaggtgctctttgatgctgccgacgccaacgccattgaggag
gtgaacctggcctacgagaatgtcaaggaagtcgatggtctggatgtttccaaagaaggg
acggaagcctgggaggccgcgatgaagagatacgatgagaggatcgaccgtgtggagacc
cgcatcaccgcccgcctccgagatcagctcggcacggccaagaatgccaatgagatgttc
aggattttctccaggttcaatgcactgttcgtccgcccacacatccgaggggccattcgt
gaataccagacccagctgatccaacgtgtgaaagatgacatcgaatctctgcacgacaag
ttcaaggtccagtacccgcaaagccaagcttgtaaaatgagtcatgtccgtgacctgccc
cccgtgtcagggtctatcatctgggctaaacagatcgacagacagctcactgcctacatg
aagcgagtggaggatgtcctgggcaaaggctgggagaaccacgtggaagggcagaagctg
aagcaggatggagacagcttccgaatgaagctcaacacccaggagatcttcgatgactgg
gcgaggaaggttcagcagcgcaaccttggtgtctccgggcgcatcttcaccattgagagc
gctcgcgtgcggggccgcactgggaatgtcctcaagctaaaggtgaacttccttccagag
atcataacactctccaaagaagtccggaacctcaagtggcttggcttccgagtgccactt
gcaattgtgaacaaggctcaccaagccaaccagctctacccatttgccatctcgctgatt
gaaagcgtccggacttacgagcgcacctgtgagaaggtggaggagcgcaataccatttcc
ctgctagtggccggcctaaagaaggaggtgcaggccttaatcgcagaaggcatcgcgttg
gtgtgggagtcctacaagctcgacccctacgtgcagcgcctggcagagacggttttcaac
ttccaggagaaggtggacgacctactgattattgaggaaaagatagacctggaggtccgc
tccttggaaacctgcatgtatgaccacaagacattctcagagatcttgaacagagtgcag
aaagcagtggacgacctaaacctgcactcctattccaatctgcccatctgggtcaacaag
ctggacatggagattgaaaggatactgggcgtccgcctgcaagctggccttcgagcttgg
acccaggttcttcttggacaagctgaggataaagcagaagtcgacatggatacagatgct
ccacaagtcagtcacaagcctggtggagagcccaagatcaaaaacgtggttcacgagctg
aggataacaaatcaggtcatctatctgaacccacccattgaggagtgcaggtacaagctg
taccaggagatgttcgcgtggaagatggttgtgctgtccctgcccaggatccagagccag
aggtaccaggtgggagtgcattacgagttgacggaggaagagaagttctatcggaatgca
ctgacaaggatgcccgacggccctgtcgccctggaagagtcctactctgcggtcatgggc
atagtgactgaagttgagcagtatgttaaggtttggcttcagtaccagtgtttgtgggat
atgcaggcagaaaacatttacaacaggctaggggaagatctcaacaagtggcaagctctc
ctggtccagataaggaaagccagaggaacctttgacaatgcggaaaccaagaaagagttt
ggtccggtggtgatagattacggcaaggtccagtccaaggtgaacttgaagtatgactcc
tggcataaggaggttctcagcaagtttgggcagatgctgggctcaaacatgacagaattc
cactcccagatctcaaagtctcgccaagagctggagcagcactccgttgacacagccagt
acctctgacgcggtgaccttcatcacctatgtgcaatctctgaaacggaagatcaaacag
tttgagaagcaagttgaactctaccgcaatggtcagcgtctgctggaaaaacaaaggttc
cagttcccgccttcttggctttacattgacaacatcgagggtgagtggggggccttcaat
gacatcatgcggcggaaggactctgccattcagcaacaggtggcaaacctgcaaatgaag
atcgtacaggaggacagagctgtggaaagccggaccacggatctgttgacagactgggag
aagaccaaacctgtcacaggcaatctgcgtcctgaggaggctcttcaggccctcaccata
tatgaagggaagttcggccggctgaaggacgacagagagaaatgtgcaaaggctaaggaa
gcgttggaactcacagacacaggcctcctcagtggcagtgaagagcgtgtacaggtggcc
ttggaggagttacaagacctcaaaggtgtgtggtcagagctttctaaggtctgggaacaa
attgatcaaatgaaggagcagccgtgggtctccgttcagcctcggaagcttcgacaaaac
ctagacggcctcttgaaccagctgaagaacttccctgcgaggcttcggcagtatgcttcc
tatgagtttgttcagaggctgctgaaaggctacatgaagataaacatgttggtaattgaa
ctgaaatcagaagcactcaaagaccggcactggaaacagctgatgaagaggcttcatgtt
aactgggtggtttctgagctgacgctgggccagatctgggacgtggaccttcagaagaac
gaagctgtcgtcaaggatgtgctgctggtggcacaaggcgagatggccttggaagaattt
ttgaagcagatacgagaagtgtggaacacatacgaactagacttggtcaactatcagaac
aaatgccgcctcatccgaggctgggatgacctcttcaacaaggtcaaggagcatatcaac
agcgtctctgccatgaaactctctccctattacaaggtttttgaagaagatgccctgagc
tgggaggacaagctgaaccgaatcatggctctctttgacgtgtggattgacgtgcagagg
cgctgggtctacttggaaggcatcttcacaggcagtgcggacatcaaacatctgctgcct
gtggaaacccagcgcttccagagtatcagcacggagtttttggctctgatgaaaaaagtc
tccaagtctccacttgtgatggatgttctgaacatacagggagtccagaggtctctggaa
aggttggcagacctgctggggaagatccagaaagcattgggggagtacctggaacgggag
cgctcgtctttccccaggttctactttgtgggtgatgaggatttgcttgagatcattggg
aatagcaagaacgtggctaagttgcagaagcacttcaagaaaatgttcgccggcgtttcc
agcatcatcttaaatgaggataactctgtggtcctcggcatctcatcccgagaaggggag
gaggttatgtttaaaactccagtgtccatcactgaacaccccaaaatcaatgagtggctc
actctggtggaaaaggagatgagagtcaccttggctaaacttctggcagagtctgttaca
gaagtggagatttttggaaaagcaacttctattgacccaaatacctacattacttggatt
gataaataccaggcccagctagtggtattgtcagcccagatagcctggtccgagaacgtg
gagaatgcgctgagcaacgttgggggaggtggtgatgtggggcccttgcagtctgtgctg
agcaatgtggaggtcacactcaacgtcttagcggactctgtcctcatggagcagcctcct
ctccggagacggaagctggagcacttgatcacagagctggttcaccaaagagacgttacc
aggtccttgatcaaaagcaagatcgacaacgccaaatctttcgaatggctcagccagatg
cgattttactttgaccctaagcaaacggacgtgttacagcagctgtccattcagatggcc
aatgccaagtttaactacggctttgagtacctgggtgttcaagacaagctggttcagacg
cccctcactgaccgttgctatttgacaatgacacaagctttggaggccaggcttgggggc
tccccatttggacctgctggaaccggaaagacagagtccgtcaaagccctcggccatcag
ctggggcggttcgtcttagttttcaactgtgacgaaacctttgatttccaggcgatggga
cgtatctttgtggggctttgccaagtgggcgcgtggggctgctttgatgagtttaaccgc
ctggaggagcggatgctctcagctgtatcccagcaggtgcagtgcatacaagaggcactg
cgggagcattccaaccccaactacgacaagacctcagcccccattacttgtgagctgctg
aacaaacaagtcaaggttagcccagacatggctatcttcatcaccatgaacccaggctat
gcaggtcgctcaaacctccccgacaacctcaagaagctcttccggagcttggcgatgacc
aagcctgaccggcagctgatcgcccaggtcatgctgtactcgcagggcttccggactgct
gaggtccttgccaacaagatcgtcccgttcttcaaactgtgtgatgagcaactgtcttct
caaagccattatgactttgggcttcgggctttgaagagtgtgcttgtaagtgcaggcaat
gtgaagagggagaggatccagaagataaagagggagaaagaagaacggggggaagcagtt
gatgaaggagagattgctgagaacctacctgagcaggagattctgatccagagtgtctgc
gagacaatggtgcccaagctggtggcagaagatatcccgctgctcttcagcctcctgtct
gacgtgtttcctggagtccagtaccaccgtggggagatgacagcccttcgagaagagctg
aagaaagtgtgtcaggagatgtacttgacatatggcgacggagaagaagttggcgggatg
tgggttgaaaaggttctccagctctatcagatcacgcagattaaccacggcctgatgatg
gttgggccttcaggaagtgggaagagcatggcctggcgagtgctgctgaaggctctagag
aggcttgagggtgtggagggcgtggcccacataattgaccccaaggccatcagcaaagac
cacctctacggaaccttggatcccaacaccagggagtggacagacggactcttcacacac
gtgctgagaaagatcatagacaatgtgagaggtgagctgcagaaacgccagtggattgtc
tttgatggcgatgtggaccccgagtgggtggagaacctgaactccgtgctggatgacaac
aagctcctgacgctgcctaatggagagcgccttagcctgcctcccaatgtgcgaataatg
tttgaagtgcaggacttgaaatacgcgacgctggccacggtgtctcgctgtggcatggtg
tggttcagtgaggacgtcctgagcacagacatgatcttcaataacttcctggccaggctg
cgcagcattcccctggatgaaggggaggacgaggcacagcgtaggcgaaaaggcaaagaa
gacgagggcgaagaggccgcttctccaatgctgcagattcaaagagatgcagcaacgatc
atgcagccgtacttcacgtccaacggcctggtcaccaaggcgctggagcacgccttcaag
ctggagcacatcatggacctgacgcgcctgcgctgcctgggctcgctcttctccatgctg
caccaggcctgccgcaacgtggcgcagtacaatgccaaccatcctgatttccccatgcag
attgagcagctggagcgctacattcagcgctatctggtttacgccatcctctggtcctta
tctggagacagccggctgaagatgagagcagagctgggcgagtacatccggaggatcacc
actgtgccgctgcccactgcgcccaacgtccccatcattgactatgaggtgtccatcagt
ggagagtggtcgccgtggcaggccaaggtgcctcagattgaagtggagacacacaaggtg
gcagccccagatgtcgtcgtgccaaccttagatacagtccgccatgaagctctcctgtac
acttggctggctgaacacaaacccctggtcttatgtggccctcctgggtctggcaagacc
atgacactcttcagtgctctccgggccttgcctgacatggaggttgtgggcctaaacttc
tcaagtgccactacaccagagctgttgctgaagacgtttgaccactactgcgaatacagg
cgtacacctaacggtgttgtcttggctcctgttcagcttggaaagtggctggtcttgttc
tgtgatgaaatcaacttgcccgatatggataaatacggcacacagagagtcatctccttc
atcagacagatggtggagcatggaggcttctatcgtacctcagaccaaacgtgggtaaag
ctagagagaatccagtttgttggggcttgcaatccacccactgaccctgggagaaagccc
ctctcacacaggttcttgcgccacgtgcctgttgtatatgtggattacccaggaccagcc
tccctgacgcaaatctatggcacttttaaccgcgccatgctgaggctcattccctcgctc
cgtacctatgcagaacccctcactgccgccatggtggagttctataccatgtcacaggag
cggtttactcaggacacacagccacactatatctactcgccccgtgagatgactcggtgg
gtaagaggaatctttgaagcactgagacccctggagacattgcctgttgaaggtctcatt
cgtatttgggcacatgaagccctccgtctcttccaagacaggcttgtggaggatgaggag
cggcgctggactgacgaaaacattgacatggttgccttgaagcacttccctaacatagac
aaagagaaagccatgagccggcctatcctgtacagcaactggctgtcaaaggattatatc
ccagttgaccaagaagagctaagggattatgtcaaggctaggctgaaggtcttctatgaa
gaagaacttgatgttcccttggtcttattcaatgaagttctggaccatgtgctgaggatc
gacagaatattccgacaacctcaaggccatctgcttctgattggtgttagtggagctgga
aaaaccaccctgtctcgctttgtcgcctggatgaatggcttgagtgtataccagattaag
gtccacaggaagtacactggggaagacttcgatgaagatcttaggacagtgctgagacgg
tctggctgtaaaaatgaaaagatagcattcataatggatgagtccaacgtcttagattcc
ggattcctggaacgaatgaatacccttctggctaatggcgaggttcctgggctctttgaa
ggggatgagtatgccacgctgatgacacagtgcaaagagggggcccagaaggaggggctc
atgctggactcccacgaggagctctacaagtggttcaccagccaggtgatccgcaacctg
cacgtggtcttcaccatgaacccgtcctcagaggggctcaaggacagggcggccacctca
ccagcccttttcaacaggtgtgtgctgaactggtttggtgactggtccactgaagcactg
tatcaagtcggcaaagaattcaccagtaagatggacctggagaagccgaactatatagtg
cctgactacatgccagttgtgtatgataaactgccgcagcccccaacacaccgggaagcc
attgtgaacagctgtgtgtttgtccatcagactcttcaccaggctaatgcgcgcctggcg
aagcgaggtggcagaacgatggccatcacacctcggcactacctggacttcatcaaccac
tacgccaacctcttccatgagaagcgcagcgagttggaggagcagcagatgcacctgaat
gttgggctccgaaaaatcaaagagaccgtggaccaggtggaagaactgcgccgtgacctg
aggatcaagagccaagagctggaggtcaagaacgcagcggccaatgacaagctgaagaaa
atggtgaaagaccagcaagaggctgagaagaagaaggtcatgagccaagaaatccaggag
cagctacacaaacagcaggaagtgatcgcagacaagcagatgagtgtcaaggaggacctg
gataaagtggagcctgctgtcatcgaggcccagaacgctgtgaagtccatcaagaagcag
cacctggtggaggtgaggtccatggccaaccctcctgcagctgtgaagctggctctggag
tccatctgcctgctgcttggtgagagcaccacggactggaagcagatccgctccatcatc
atgagagagaacttcatccccaccatcgtcaacttctcggctgaggagatcagtgatgcc
atacgagagaagatgaagaaaaactacatgtccaaccccagttacaactatgagatcgtc
aaccgggcttccctggcttgtggtcctatggtgaagtgggcgattgcacagctcaattat
gcagacatgttaaagcgagtggagcccctgaggaatgagctgcagaagctggaagatgac
gccaaggacaaccagcagaaagccaatgaggtggagcagatgatcagggacctggaagcc
agcattgcccgctacaaggaggagtacgctgtcctcatctctgaggcccaggccatcaag
gcagacctggcagctgtggaagcaaaggtaaaccggagcactgcacttctaaagagttta
tctgccgaaagggaacgttgggaaaagacgagtgaaactttcaaaaaccagatgtctacc
attgctggggactgcctcctgtcggcggccttcattgcttacgctggctactttgaccag
caaatgcgccagaacttgttcaccacctggtctcatcacttacagcaagccaacatccag
ttccgcacagacattgcaaggacggagtacctctccaatgctgacgaacgcctccgctgg
caggccagctctctgcctgccgacgacctgtgcacagagaatgccatcatgctaaaacga
ttcaataggtacccgctgatcatcgacccctccggacaggccacagaattcatcatgaat
gaatataaggaccggaagatcacaaggaccagcttcttagatgatgccttccggaagaat
ttggagagtgctctgagatttggcaatccccttcttgtccaggatgtggaaagctacgat
ccagttttgaatccagtactgaaccgtgaagttcggcgaacaggagggagggtgctgatt
accctcggtgaccaagacatagacctgtcaccatcctttgtcatctttctgtctacccga
gacccaactgtggagttcccaccagacctctgctcccgggtgacctttgtgaacttcacc
gtcacccgcagcagtttacagagccagtgtctcaatgaagtgcttaaagcagaaaggcca
gacgtggacgagaagcgctccgacctcctgaaactgcaaggggagttccaactccgttta
cggcagcttgaaaagtctctgctccaagctctgaatgaggtaaaaggccgcattctggat
gacgacaccatcattacaaccctggagaatctgaagcgggaagctgccgaggttaccaga
aaggtggaggagacagatattgtcatgcaggaggtggagaccgtgtcccagcagtacctg
ccgctgtccactgcctgcagcagcatctacttcactatggagtccttgaagcaggttcac
ttcctgtaccagtactctctgcagttcttcctggacatctaccacaacgtgctgtatgag
aaccccaacctgaagggtgccaccgatcacacacagcgcctctccatcataaccaaggac
ctcttccaggtggcctttaaccgagtggctcgaggcatgctgcaccaggaccacatcacc
ttcgccatgctgctagcgaggatcaagctgaaaggcaccgtgggggagcccacctatgat
gcagagttccagcacttcctcagagggaaggagattgtgctgagtgctggctccaccccc
aaaatccagggcctgaccgtagagcaggcagaagctgtcgtgaggttgagctgtctgcct
gcatttaaagatctgattgccaaggtgcaggcagatgagcagtttggcatttggctggat
agcagttcaccagagcagaccgtgccatacctctggagcgaggaaacgcctacaactccc
attgggcaggccatccaccgcctgctcctgattcaagccttccgacccgaccgcctgttg
gccatggcccacatgtttgtttccacaaacctcggagagtccttcatgtccatcatggag
cagcctctcgacctcacccacattgtgggcacagaggtgaagccaaacacacctgtcctg
atgtgctctgtgcctgggtatgatgccagcggacatgttgaggacctcgcagcagagcag
aacacgcagatcacgtctattgccatcggctcagcagaaggctttaaccaagcagataag
gccatcaacaccgccgtgaagtcaggcaggtgggtgatgttgaagaacgtgcacctggcc
ccgggctggctgatgcagctggagaagaagctgcactccctgcagccccacgcctgcttc
cgacttttcctcaccatggagatcaaccccaaggtgcccgtgaacctgctccgtgctggt
cggatctttgtgtttgagccaccacccggagtgaaagccaacatgctgaggacatttagc
agcatccctgtctctaggatatgcaagtctccaaatgagcgcgcccgcttgtatttcctg
ctggcttggttccatgccatcatccaagagcgcctgcgctatgctccactggggtggtca
aagaagtacgaatttggagaatctgaccttcgatcagcttgtgacacggtggacacgtgg
ctggacgacacagccaagggccggcagaacatctcaccggataagatcccatggtctgcc
ctgaagaccctgatggcgcagtccatctatggtgggcgggtggacaatgagttcgaccag
cgtctgctcaacaccttcctggagcggctgttcaccacccgcagcttcgacagtgaattc
aagctggcgtgcaaggttgacgggcacaaggacatccagatgcctgatggtatcaggcga
gaggagtttgtgcagtgggtggagctgctgcctgacgcccagacaccctcatggctgggc
ctccccaacaatgctgaaagggtcctgcttaccacccaaggcgtggacatgatcagcaag
atgctgaagatgcagatgctggaggacgaggatgacctggcctacgcagagacggagaag
aaggcaaggacggactccacctccgatggccgtccagcctggatgaggacactgcacacc
acggcgtccaactggctgcacctcatcccacagacactgagccccctgaagcgcaccgtg
gagaacatcaaggatcctttgtttaggttctttgagagagaagtaaagatgggggccaag
ttactccaagatgtgcgccaagatcttgctgacgtcgttcaagtgtgcgaggggaaaaag
aagcagacaaactacctgcgcacgctcatcaatgagctggtgaaagggatcttgcctcgg
agctggtcccattacacagtgcctgcaggcatgactgtgatccagtgggtgtcagatttc
agcgagaggatcaaacagctgcagaacatctcacaagcagctgcatctggtggtgccaag
gaactgaagaacatccacgtgtgcctgggtggcctgtttgtacctgaggcctacatcact
gccaccagacagtatgtggcacaagctaacagctggtccctggaggaactctgcctggaa
gtcaatgtcaccgcctcacagagtgccacccttgatgcctgcagctttggagtcacaggt
ctgaagctccaaggggccacgtgcagcaacaacaagctatcactctccaatgccatctcc
acagtcctccccctcacacagctgcgctgggtgaaacaaacaagcgccgagaagaaggcc
agcgtggtgaccttacctgtctacctgaacttcacccgggcagacctcatcttcaccgtg
gactttgaaattgctacaaaggaagatcctcgcagcttctatgagcgtggagttgccgtt
ctgtgcactgagtaa

DBGET integrated database retrieval system