KEGG   Mus musculus (house mouse): 13427
Entry
13427             CDS       T01002                                 
Symbol
Dync1i2, 3110079H08Rik, AW554389, Dncic2
Name
(RefSeq) dynein cytoplasmic 1 intermediate chain 2
  KO
K10415  dynein cytoplasmic 1 intermediate chain
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04145  Phagosome
mmu04962  Vasopressin-regulated water reabsorption
mmu05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    13427 (Dync1i2)
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    13427 (Dync1i2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    13427 (Dync1i2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    13427 (Dync1i2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    13427 (Dync1i2)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Motor proteins
     Dynein complex
      13427 (Dync1i2)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     13427 (Dync1i2)
SSDB
Motif
Pfam: Dynein_IC2 WD40 ANAPC4_WD40
Other DBs
NCBI-GeneID: 13427
NCBI-ProteinID: NP_001185805
MGI: 107750
Ensembl: ENSMUSG00000027012
UniProt: O88487 A2BFF7
Position
2:71041999..71093647
AA seq 612 aa
MSDKSDLKAELERKKQRLAQIREEKKRKEEERKKKETDQKKEAAVSVQEESDLEKKRREA
EALLQSMGLTTDSPIVPPPMSPSSKSVSTPSEAGSQDSGDGAVGSRRGPIKLGMAKITQV
DFPPREIVTYTKETQTPVTAQPKEDEEEEDDVATPKPPVEPEEEKTLKKDEENDSKAPPH
ELTEEEKQQILHSEEFLSFFDHSTRIVERALSEQINIFFDYSGRDLEDKEGEIQAGAKLS
LNRQFFDERWSKHRVVSCLDWSSQYPELLVASYNNNEEAPHEPDGVALVWNMKYKKTTPE
YVFHCQSAVMSATFAKFHPNLVVGGTYSGQIVLWDNRSNKRTPVQRTPLSAAAHTHPVYC
VNVVGTQNAHNLISISTDGKICSWSLDMLSHPQDSMELVHKQSKAVAVTSMSFPVGDVNN
FVVGSEEGSVYTACRHGSKAGISEMFEGHQGPITGIHCHAAVGAVDFSHLFVTSSFDWTV
KLWTTKNNKPLYSFEDNSDYVYDVMWSPTHPALFACVDGMGRLDLWNLNNDTEVPTASIS
VEGNPALNRVRWTHSGREIAVGDSEGQIVIYDVGEQIAVPRNDEWARFGRTLAEINANRA
DAEEEAATRIPA
NT seq 1839 nt   +upstreamnt  +downstreamnt
atgtcggacaaaagtgatttaaaagctgagttggaacgtaagaagcaacggttggcccaa
atcagagaagaaaagaagaggaaagaagaggaaaggaaaaaaaaggaaactgatcagaag
aaggaagctgctgtttctgtacaagaagagtctgatcttgaaaaaaaaagaagagaagct
gaggcattgcttcaaagcatgggactaactacggactcccctattgtccctcctcctatg
tctccatcctccaagtcggtgagcacgccaagtgaagctggaagccaggattctggagat
ggcgccgtgggatctagacgaggacctattaaacttggaatggccaaaattactcaagtt
gactttccccctcgagaaatcgtcacatacacaaaggaaactcagaccccggttacagct
caacccaaagaagatgaggaggaggaagatgatgtagcaactcctaaacctcctgttgaa
cctgaagaagagaaaactttgaaaaaagacgaagagaatgatagcaaagctccacctcat
gaactaactgaagaagaaaagcaacagattttacactcagaagaatttttaagtttcttt
gaccattctacgagaattgtagaaagagccctttctgagcagattaacatcttctttgac
tacagtgggagagacttggaagacaaagaaggggagattcaagcaggtgctaagctgtca
ttaaatcgacagttctttgatgagcgttggtcaaagcatcgagttgttagttgtttggat
tggtcatcccagtatccagaattacttgtggcttcctataataacaatgaagaggctcct
catgagcctgatggtgtggccctcgtgtggaatatgaagtacaaaaaaactaccccagag
tatgtgttccactgccagtcagctgtaatgtctgctacatttgcaaaatttcatccgaat
cttgttgttggaggtacatattcaggccagattgtgctttgggataaccgcagcaataaa
agaactcctgtccagagaacgccgctgtcagctgctgcacacacacaccctgtctactgt
gtaaatgttgttggaacacaaaatgctcacaatctgattagcatctctactgatggaaaa
atttgttcctggagtttggacatgctttcccatccacaggatagcatggagttggttcat
aaacagtcaaaggcagtagctgtaacatctatgtctttccctgttggagacgtcaacaac
tttgttgtgggcagtgaagaaggttctgtgtatacagcatgccgccatggcagcaaagct
ggaatcagtgagatgtttgagggacaccagggacccatcactggaatccactgtcacgcg
gctgttggagcagtagacttctcacatctgtttgtcacttcgtcttttgactggacagtt
aaactttggacaactaagaataacaagcctttgtactcatttgaagataattcagactat
gtctatgatgttatgtggtcacccacccacccagccctgtttgcctgtgtggacggcatg
gggagactggatctatggaatctcaacaatgacacagaggtaccaactgccagcatttct
gtggagggcaaccctgctcttaaccgtgtgagatggacccactcaggaagagaaattgcc
gtgggtgattctgaaggacagattgtcatctatgatgtgggagagcagatcgctgttccc
cgaaatgatgaatgggcaagatttggccgaacactcgcagaaattaacgcaaaccgagct
gacgcagaggaggaggcagctacccgaatccctgcctag

DBGET integrated database retrieval system