KEGG   Mus musculus (mouse): 13435Help
Entry
13435             CDS       T01002                                 

Gene name
Dnmt3a, MmuIIIA
Definition
(RefSeq) DNA methyltransferase 3A
  KO
K17398  DNA (cytosine-5)-methyltransferase 3A [EC:2.1.1.37]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00270  Cysteine and methionine metabolism
mmu01100  Metabolic pathways
mmu05206  MicroRNAs in cancer
Module
mmu_M00035  Methionine degradation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    13435 (Dnmt3a)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    13435 (Dnmt3a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mmu03032]
    13435 (Dnmt3a)
   03036 Chromosome and associated proteins [BR:mmu03036]
    13435 (Dnmt3a)
Enzymes [BR:mmu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.37  DNA (cytosine-5-)-methyltransferase
     13435 (Dnmt3a)
DNA replication proteins [BR:mmu03032]
 Eukaryotic type
  DNA Replication Termination Factors
   DNA methylation enzymes
    13435 (Dnmt3a)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    13435 (Dnmt3a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADD_DNMT3 DNA_methylase PWWP
Motif
Other DBs
NCBI-GeneID: 13435
NCBI-ProteinID: NP_001258682
MGI: 1261827
Ensembl: ENSMUSG00000020661
Vega: OTTMUSG00000037610
UniProt: O88508
Position
12; 12 A1.1
AA seq 908 aa AA seqDB search
MPSSGPGDTSSSSLEREDDRKEGEEQEENRGKEERQEPSATARKVGRPGRKRKHPPVESS
DTPKDPAVTTKSQPMAQDSGPSDLLPNGDLEKRSEPQPEEGSPAAGQKGGAPAEGEGTET
PPEASRAVENGCCVTKEGRGASAGEGKEQKQTNIESMKMEGSRGRLRGGLGWESSLRQRP
MPRLTFQAGDPYYISKRKRDEWLARWKREAEKKAKVIAVMNAVEENQASGESQKVEEASP
PAVQQPTDPASPTVATTPEPVGGDAGDKNATKAADDEPEYEDGRGFGIGELVWGKLRGFS
WWPGRIVSWWMTGRSRAAEGTRWVMWFGDGKFSVVCVEKLMPLSSFCSAFHQATYNKQPM
YRKAIYEVLQVASSRAGKLFPACHDSDESDSGKAVEVQNKQMIEWALGGFQPSGPKGLEP
PEEEKNPYKEVYTDMWVEPEAAAYAPPPPAKKPRKSTTEKPKVKEIIDERTRERLVYEVR
QKCRNIEDICISCGSLNVTLEHPLFIGGMCQNCKNCFLECAYQYDDDGYQSYCTICCGGR
EVLMCGNNNCCRCFCVECVDLLVGPGAAQAAIKEDPWNCYMCGHKGTYGLLRRREDWPSR
LQMFFANNHDQEFDPPKVYPPVPAEKRKPIRVLSLFDGIATGLLVLKDLGIQVDRYIASE
VCEDSITVGMVRHQGKIMYVGDVRSVTQKHIQEWGPFDLVIGGSPCNDLSIVNPARKGLY
EGTGRLFFEFYRLLHDARPKEGDDRPFFWLFENVVAMGVSDKRDISRFLESNPVMIDAKE
VSAAHRARYFWGNLPGMNRPLASTVNDKLELQECLEHGRIAKFSKVRTITTRSNSIKQGK
DQHFPVFMNEKEDILWCTEMERVFGFPVHYTDVSNMSRLARQRLLGRSWSVPVIRHLFAP
LKEYFACV
NT seq 2727 nt NT seq  +upstreamnt  +downstreamnt
atgccctccagcggccccggggacaccagcagctcctctctggagcgggaggatgatcga
aaggaaggagaggaacaggaggagaaccgtggcaaggaagagcgccaggagcccagcgcc
acggcccggaaggtggggaggcctggccggaagcgcaagcacccaccggtggaaagcagt
gacacccccaaggacccagcagtgaccaccaagtctcagcccatggcccaggactctggc
ccctcagatctgctacccaatggagacttggagaagcggagtgaaccccaacctgaggag
gggagcccagctgcagggcagaagggtggggccccagctgaaggagagggaactgagacc
ccaccagaagcctccagagctgtggagaatggctgctgtgtgaccaaggaaggccgtgga
gcctctgcaggagagggcaaagaacagaagcagaccaacatcgaatccatgaaaatggag
ggctcccggggccgactgcgaggtggcttgggctgggagtccagcctccgtcagcgaccc
atgccaagactcaccttccaggcaggggacccctactacatcagcaaacggaaacgggat
gagtggctggcacgttggaaaagggaggctgagaagaaagccaaggtaattgcagtaatg
aatgctgtggaagagaaccaggcctctggagagtctcagaaggtggaggaggccagccct
cctgctgtgcagcagcccacggaccctgcttctccgactgtggccaccacccctgagcca
gtaggaggggatgctggggacaagaatgctaccaaagcagccgacgatgagcctgagtat
gaggatggccggggctttggcattggagagctggtgtgggggaaacttcggggcttctcc
tggtggccaggccgaattgtgtcttggtggatgacaggccggagccgagcagctgaaggc
actcgctgggtcatgtggttcggagatggcaagttctcagtggtgtgtgtggagaagctc
atgccgctgagctccttctgcagtgcattccaccaggccacctacaacaagcagcccatg
taccgcaaagccatctacgaagtcctccaggtggccagcagccgtgccgggaagctgttt
ccagcttgccatgacagtgatgaaagtgacagtggcaaggctgtggaagtgcagaacaag
cagatgattgaatgggccctcggtggcttccagccctcgggtcctaagggcctggagcca
ccagaagaagagaagaatccttacaaggaagtttacaccgacatgtgggtggagcctgaa
gcagctgcttacgccccacccccaccagccaagaaacccagaaagagcacaacagagaaa
cctaaggtcaaggagatcattgatgagcgcacaagggagcggctggtgtatgaggtgcgc
cagaagtgcagaaacatcgaggacatttgtatctcatgtgggagcctcaatgtcaccctg
gagcacccactcttcattggaggcatgtgccagaactgtaagaactgcttcttggagtgt
gcttaccagtatgacgacgatgggtaccagtcctattgcaccatctgctgtggggggcgt
gaagtgctcatgtgtgggaacaacaactgctgcaggtgcttttgtgtcgagtgtgtggat
ctcttggtggggccaggagctgctcaggcagccattaaggaagacccctggaactgctac
atgtgcgggcataagggcacctatgggctgctgcgaagacgggaagactggccttctcga
ctccagatgttctttgccaataaccatgaccaggaatttgaccccccaaaggtttaccca
cctgtgccagctgagaagaggaagcccatccgcgtgctgtctctctttgatgggattgct
acagggctcctggtgctgaaggacctgggcatccaagtggaccgctacattgcctccgag
gtgtgtgaggactccatcacggtgggcatggtgcggcaccagggaaagatcatgtacgtc
ggggacgtccgcagcgtcacacagaagcatatccaggagtggggcccattcgacctggtg
attggaggcagtccctgcaatgacctctccattgtcaaccctgcccgcaagggactttat
gagggtactggccgcctcttctttgagttctaccgcctcctgcatgatgcgcggcccaag
gagggagatgatcgccccttcttctggctctttgagaatgtggtggccatgggcgttagt
gacaagagggacatctcgcgatttcttgagtctaaccccgtgatgattgacgccaaagaa
gtgtctgctgcacacagggcccgttacttctggggtaaccttcctggcatgaacaggcct
ttggcatccactgtgaatgataagctggagctgcaagagtgtctggagcacggcagaata
gccaagttcagcaaagtgaggaccattaccaccaggtcaaactctataaagcagggcaaa
gaccagcatttccccgtcttcatgaacgagaaggaggacatcctgtggtgcactgaaatg
gaaagggtgtttggcttccccgtccactacacagacgtctccaacatgagccgcttggcg
aggcagagactgctgggccgatcgtggagcgtgccggtcatccgccacctcttcgctccg
ctgaaggaatattttgcttgtgtgtaa

DBGET integrated database retrieval system