KEGG   Mus musculus (mouse): 13437
Entry
13437             CDS       T01002                                 

Gene name
Dnpep, AA407814
Definition
(RefSeq) aspartyl aminopeptidase
  KO
K01267  aspartyl aminopeptidase [EC:3.4.11.21]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    13437 (Dnpep)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    13437 (Dnpep)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.21  aspartyl aminopeptidase
     13437 (Dnpep)
Peptidases and inhibitors [BR:mmu01002]
 Metallo peptidases
  Family M18
   13437 (Dnpep)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Cytoplasm to vacuolar targeting (CVT) pathway
   Selective cargos
    13437 (Dnpep)
Motif
Pfam: Peptidase_M18 Peptidase_M42
Other DBs
NCBI-GeneID: 13437
NCBI-ProteinID: NP_058574
MGI: 1278328
Ensembl: ENSMUSG00000026209
Vega: OTTMUSG00000048821
UniProt: Q9Z2W0
Position
1; 1 C4
AA seq 473 aa
MAMNGRARKEAIQATARELLKFVNRSPSPFHVVAECRSRLLQAGFRELKETEGWDIVPEN
KYFLTRNSSSIIAFAVGGQYVPGNGFSLIGAHTDSPCLRVKRKSRRSQVGYHQVGVETYG
GGIWSTWFDRDLTLAGRVIIKCPTSGRLEQRLVHIERPILRIPHLAIHLQRNINENFGPN
TEIHLVPILATAVQEELEKGTPEPGPLGATDERHHSVLMSLLCTHLGLSPDSIMEMELCL
ADTQPAVLGGAYEEFIFAPRLDNLHSCFCALQALIDSCASPASLARDPHVRMVTLYDNEE
VGSESAQGAQSLLTELILRRISASPQRLTAFEEAIPKSFMISADMAHAVHPNYSDKHEEN
HRPLFHKGPVIKVNSKQRYASNAVSESMIREVAGQVGVPLQDLMVRNDSPCGTTIGPILA
SRLGLRVLDLGSPQLAMHSIRETACTTGVLQTLTLFKGFFELFPSVSRNLLVD
NT seq 1422 nt   +upstreamnt  +downstreamnt
atggctatgaacggcagggctcggaaagaggccatccaggccacagcccgagagctcctg
aagttcgtgaaccggagtccctctcctttccacgtcgtggctgagtgccgcagccgcctc
ctccaggctggcttccgtgaactcaaggaaacagagggctgggatatcgtaccagaaaac
aagtacttcttaaccagaaactcctcctccatcattgcttttgctgtggggggccagtat
gttcctggcaatggcttcagcctcattggggcccacacggacagtccctgtctcagggtg
aaacgcaaatcgcgccgaagccaggtgggctaccaccaggtcggtgttgagacctacggc
ggtgggatctggagcacatggttcgaccgggacctgaccttggctggacgcgtcattatc
aagtgccctacctcaggccggctggagcagaggctcgtccatatagaacggcccatcctg
cgcatcccacatctggccatccatctgcagcgaaatatcaatgagaactttgggcccaac
acagagatccacctagtccctattcttgccacagcagttcaggaagagctggagaaaggg
actcctgaaccagggcctctcggtgccactgatgagcggcaccactcggtcctcatgtcc
ctgctctgtacccatctgggcctgagtcctgacagcatcatggagatggagctctgcctg
gcagacacccagcctgcagtcctgggtggagcctatgaagagttcatcttcgctcctcga
ctggacaatctgcacagctgcttctgtgccctgcaggcattgattgattcctgtgcatcc
cctgcctctctggccagggatccacatgtgcgcatggtcacactctacgacaatgaagag
gtggggtcagagagtgcacaaggagcacagtccctgctgacggagctgatactacggcgc
atctcagcctcacctcagcgtctgactgccttcgaggaagccatacctaagtccttcatg
atcagtgcagacatggcccatgctgtgcacccaaactactcggacaagcatgaagaaaac
caccggcctttgttccataagggtcctgtgatcaaggtgaacagcaagcagcgctacgcc
tctaatgcagtgtctgagtccatgattcgagaggtggctggccaagttggggtgcccctg
caggacctcatggtcaggaatgactccccgtgtggtaccaccattggacctatcttggct
tctcgactggggcttcgggtgctggacttaggcagcccccaactggctatgcactctatc
cgggagacagcctgtaccactggagttctccagaccctcacccttttcaagggcttcttt
gagctgttcccttctgtaagccggaacctcttagtggactga

DBGET integrated database retrieval system