KEGG   Mus musculus (mouse): 13445Help
Entry
13445             CDS       T01002                                 

Gene name
Cdk2ap1, Apc10, Cdkap1, DORC1, Doc1, ST19, doc-1, p12
Definition
(RefSeq) CDK2 (cyclin-dependent kinase 2)-associated protein 1
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: CDK2AP
Motif
Other DBs
NCBI-GeneID: 13445
NCBI-ProteinID: NP_038840
MGI: 1202069
Ensembl: ENSMUSG00000029394
Vega: OTTMUSG00000024438
UniProt: O35207
Position
5; 5 F
AA seq 114 aa AA seqDB search
MSYKPNLTAHMPAAALNAGSVHSPSTSMATSSQYRQLLSDYGPPSLGYTQGTGNSQVPQS
KYAELLAIIEELGKEIRPTYAGSKSAMERLKRGIIHARSLVRECLAETERNARS
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtacaagccgaacttgaccgcgcacatgcccgccgccgccctcaacgccggaagt
gtccactcaccctctactagcatggcgacctcctcccaatatcgccagctgctgagtgac
tatgggcctccatcgctaggctacacccagggaactggaaatagccaggtgcctcagagt
aaatatgcagagctgctggccatcattgaagagttggggaaagagatcagaccgacgtat
gcagggagcaagagcgccatggagaggctaaaacgaggcatcattcatgcccggagcctg
gttcgggagtgcttggctgaaacggaacggaatgccaggtcctag

DBGET integrated database retrieval system