KEGG   Mus musculus (mouse): 13447
Entry
13447             CDS       T01002                                 

Gene name
Doc2b
Definition
(RefSeq) double C2, beta
  KO
K19917  double C2-like domain-containing protein beta
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    13447 (Doc2b)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   DOC-2 proteins
    13447 (Doc2b)
SSDB
Motif
Pfam: C2 PI3K_C2 MRI
Other DBs
NCBI-GeneID: 13447
NCBI-ProteinID: NP_031899
MGI: 1100497
Ensembl: ENSMUSG00000020848
Vega: OTTMUSG00000006220
UniProt: P70169
Position
11; 11 B5
AA seq 412 aa
MTLRRRGEKATISIQEHMAIDVCPGPIRPIKQISDYFPRFPRGLPPTAAPRAPAPPDAPA
RSPAASASPRSPSDGARDDDEDVDQLFGAYGASPGPSPGPSPARPPAKPPEDEPDVDGYE
SDDCTALGTLDFSLLYDQENNALHCTISKAKGLKPMDHNGLADPYVKLHLLPGASKANKL
RTKTLRNTLNPSWNETLTYYGITDEDMVRKTLRISVCDEDKFRHNEFIGETRVPLKKLKP
NHTKTFSICLEKQLPVDKAEDKSLEERGRILISLKYSSQKQGLLVGIVRCAHLAAMDANG
YSDPYVKTYLKPDVDKKSKHKTAVKKKTLNPEFNEEFCYEIKHGDLAKKTLEVTVWDYDI
GKSNDFIGGVVLGINAKGERLKHWFDCLKNKDKRIERWHTLTNELPGAVLSD
NT seq 1239 nt   +upstreamnt  +downstreamnt
atgaccctccggcggcgcggggagaaggcgaccatcagcatccaggagcatatggccatc
gacgtgtgtcccggccccattcggcctatcaagcagatctccgattattttccccgcttc
ccgcggggcctcccccctaccgccgcgccccgcgcccccgcgcccccggacgcccccgcg
cgctctcccgcagccagcgccagcccccgcagcccctccgacggcgcccgcgacgacgac
gaagatgtggaccagctcttcggagcctacggagccagcccaggccccagccccggcccc
agccccgcgaggccgcccgccaagccccccgaggacgagccggacgtcgacggctacgag
tcagacgactgcaccgccctgggtacgctggacttcagtctgctctatgaccaggagaac
aacgcactgcactgcaccatcagcaaggccaagggcctgaagccgatggaccacaatgga
ctggctgatccctacgtcaaactacacctgctgcctggagccagcaaggcaaataagctc
agaacaaaaactcttcggaacaccctgaacccctcgtggaacgagaccctcacttattac
ggaatcacggatgaggacatggtccgaaagaccctgaggatctccgtgtgtgatgaggac
aaattccgccacaatgagttcattggagagactcgggtgcccctgaagaagctgaagccc
aatcacaccaagacattcagcatctgcctggagaagcagctgccggtggacaaggcagag
gacaagtctctggaagagcgaggccgcatcctcatctccctcaagtacagctcacagaag
cagggcctgctggtgggcatcgtgcgctgtgcacacctggctgccatggatgctaatggc
tactcggacccctatgtgaaaacatatctgaagccagatgtagacaagaaatccaagcat
aagacagcagtgaagaagaaaacactaaacccagaattcaatgaggaattctgttacgag
atcaagcatggagacctggccaaaaagactctggaggtcactgtctgggattatgacatt
ggaaaatccaatgatttcatcggtggtgtggttctgggcatcaacgccaagggcgagcgc
ctgaagcactggtttgactgcttgaagaacaaggacaagaggattgagcgttggcacacg
ctcaccaatgagctcccaggggctgtactcagcgactga

DBGET integrated database retrieval system