KEGG   Mus musculus (mouse): 13476Help
Entry
13476             CDS       T01002                                 

Gene name
Reep5, AI324241, AU022809, AW495741, DP1/TB2, Dp1, R74856, TB2/DP1
Definition
(RefSeq) receptor accessory protein 5
  KO
K17279  receptor expression-enhancing protein 5/6
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    13476 (Reep5)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   13476 (Reep5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TB2_DP1_HVA22 Phage_holin_3_6
Motif
Other DBs
NCBI-GeneID: 13476
NCBI-ProteinID: NP_031900
MGI: 1270152
Ensembl: ENSMUSG00000005873
UniProt: Q9CQG4 G3X8R0
Position
18; 18 B1
AA seq 189 aa AA seqDB search
MSAAMRERFDRFLHEKNCMTDLLAKLEAKTGVNRSFIALGVIGLVALYLVFGYGASLLCN
LIGFGYPAYISMKAIESPNKDDDTQWLTYWVVYGVFSIAEFFSDLFLSWFPFYYMLKCGF
LLWCMAPSPANGAEMLYRRIIRPIFLKHESQVDSVVKDVKDKAKETADAISKEVKKATVN
LLGDEKKST
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcagccatgagggagaggttcgaccggttcctgcacgagaagaactgcatgact
gatctcctcgccaagctcgaggccaagaccggagtgaaccggagcttcatcgcgctcggt
gtcatcggactggtggctttgtatctggtgttcggttatggagcctctctcctctgcaac
ctgataggtttcggatacccagcctacatctcaatgaaagccatcgagagtcccaacaaa
gatgatgacacccagtggctgacgtactgggtggtatatggtgtgttcagcattgccgaa
ttcttctccgatctcttcctgtcctggttccccttctactacatgctgaagtgtggcttc
ctgctgtggtgcatggcccccagcccggctaatggggctgagatgctctacaggcgaatc
atccgtcctatcttcctcaagcacgagtcccaggtagacagtgtggtgaaggacgtgaag
gacaaagccaaagagactgcagatgccatcagcaaagaagtcaagaaagctacagtgaac
ttgctgggcgatgagaagaagagcacctga

DBGET integrated database retrieval system