KEGG   Mus musculus (mouse): 13482Help
Entry
13482             CDS       T01002                                 

Gene name
Dpp4, Cd26, Dpp-4, THAM
Definition
(RefSeq) dipeptidylpeptidase 4
  KO
K01278  dipeptidyl-peptidase 4 [EC:3.4.14.5]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    13482 (Dpp4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    13482 (Dpp4)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    13482 (Dpp4)
   04090 CD molecules [BR:mmu04090]
    13482 (Dpp4)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.5  dipeptidyl-peptidase IV
     13482 (Dpp4)
Peptidases and inhibitors [BR:mmu01002]
 Serine peptidases
  Family S9: prolyl oligopeptidase family
   13482 (Dpp4)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   13482 (Dpp4)
  Exosomal proteins of epithelial cells
   13482 (Dpp4)
  Exosomal proteins of colorectal cancer cells
   13482 (Dpp4)
CD molecules [BR:mmu04090]
 Proteins
  13482 (Dpp4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DPPIV_N Peptidase_S9 DPPIV_rep DLH LIP Abhydrolase_6 Hydrolase_4 Abhydrolase_3 AXE1 Peptidase_S15
Motif
Other DBs
NCBI-GeneID: 13482
NCBI-ProteinID: NP_034204
MGI: 94919
Ensembl: ENSMUSG00000035000
Vega: OTTMUSG00000012759
UniProt: P28843 Q3TR43
Position
2 C1.3; 2 35.85 cM
AA seq 760 aa AA seqDB search
MKTPWKVLLGLLGVAALVTIITVPIVLLSKDEAAADSRRTYSLADYLKSTFRVKSYSLWW
VSDFEYLYKQENNILLLNAEHGNSSIFLENSTFESFGYHSVSPDRLFVLLEYNYVKQWRH
SYTASYNIYDVNKRQLITEEKIPNNTQWITWSPEGHKLAYVWKNDIYVKVEPHLPSHRIT
STGEENVIYNGITDWVYEEEVFGAYSALWWSPNNTFLAYAQFNDTGVPLIEYSFYSDESL
QYPKTVWIPYPKAGAVNPTVKFFIVNIDSLSSSSSAAPIQIPAPASVARGDHYLCDVVWA
TEERISLQWLRRIQNYSVMAICDYDKINLTWNCPSEQQHVEMSTTGWVGRFRPAEPHFTS
DGSSFYKIISDKDGYKHICHFPKDKKDCTFITKGAWEVISIEALTSDYLYYISNQYKEMP
GGRNLYKIQLTDHTNVKCLSCDLNPERCQYYAVSFSKEAKYYQLGCWGPGLPLYTLHRST
DHKELRVLEDNSALDRMLQDVQMPSKKLDFIVLNETRFWYQMILPPHFDKSKKYPLLLDV
YAGPCSQKADASFRLNWATYLASTENIIVASFDGRGSGYQGDKIMHAINRRLGTLEVEDQ
IEAARQFVKMGFVDSKRVAIWGWSYGGYVTSMVLGSGSGVFKCGIAVAPVSRWEYYDSVY
TERYMGLPIPEDNLDHYRNSTVMSRAEHFKQVEYLLIHGTADDNVHFQQSAQISKALVDA
GVDFQAMWYTDEDHGIASSTAHQHIYSHMSHFLQQCFSLH
NT seq 2283 nt NT seq  +upstreamnt  +downstreamnt
atgaagacaccgtggaaggttcttctgggactgcttggtgtcgctgcgcttgtcaccatc
atcaccgtgccaatagttctgctgagcaaagatgaagcggcagctgacagccgcagaacg
tattcactagctgactatttaaagagtacctttcgggtcaagtcctactctttgtggtgg
gtttcagactttgaatacctctacaaacaagagaacaatatcttgctgctcaatgctgaa
catggaaacagctccattttcttggagaacagtacctttgaaagctttggatatcattca
gtgtcacctgaccgactgtttgttctcttggaatacaactacgtgaagcaatggagacat
tcctacacagcttcatacaacatttatgatgtgaataaaagacagctgatcacagaagag
aagattccaaataatacacagtggatcacatggtcaccagaaggtcataagttggcatat
gtctggaagaatgatatttacgttaaagttgaaccacacttacctagtcataggatcaca
tcgacaggagaagaaaatgtaatatataatggaataactgactgggtttatgaagaggaa
gtcttcggtgcctactctgcactgtggtggtctccaaacaacacgtttctagcttatgcc
cagtttaacgacacaggagtgccgctcattgaatactccttctattctgatgagtcactg
cagtaccccaagacagtgtggattccatacccaaaggcaggagctgtgaatccaactgta
aagttctttattgtaaatatagactctctcagctcatcctctagtgcggctcccatccaa
atccctgctcctgcatctgtggcaagaggggatcactatttatgtgatgtggtgtgggct
acagaagaaagaatttcactacagtggctcaggaggattcagaactattccgtgatggct
atctgtgactatgataagatcaacctaacgtggaactgtccatccgagcagcagcatgtt
gaaatgagtaccacaggctgggtcggaagatttaggcccgcagaacctcacttcacctct
gatggaagcagcttctataagatcatcagcgacaaagatggctacaaacacatctgccac
ttcccgaaagataagaaagactgtacatttattacaaaaggagcctgggaagtcattagt
atcgaagctctgaccagcgattatctatactacattagtaaccaatataaagaaatgcca
ggaggaagaaatctctataaaattcaacttactgaccacacaaatgtgaagtgccttagt
tgtgacctgaatccagaaagatgtcagtattatgcggtatcatttagtaaagaggcaaag
tactatcagctgggatgttggggccccggtctgcccctctacactctacatcgtagcacg
gatcataaagagctgcgagtcctggaagacaattctgctttggatagaatgctgcaggat
gtccagatgccttcaaaaaaattggacttcattgttttgaatgaaacaagattttggtat
caaatgatcttgccccctcattttgataaatccaagaaatatcctctactattagatgta
tatgcaggtccctgtagtcaaaaagcagatgcttccttcagactgaactgggccacttac
cttgcaagtacagaaaacatcatagtagctagctttgacggcagaggaagtggttaccaa
ggagataagatcatgcatgcaatcaacagaagattgggaacactggaagttgaagatcaa
attgaagcagccaggcaatttgtaaaaatgggatttgtggatagcaagcgagttgcaatt
tggggctggtcatatggagggtatgtaacctcaatggtcctgggatcgggaagtggcgtg
ttcaagtgcggaatagctgtggcacctgtgtcacggtgggagtactatgactcagtgtac
acagagcgttacatgggtctcccaattccagaagacaaccttgaccattacaggaactca
acagtcatgagcagagctgaacattttaaacaagttgagtacctccttattcatggaacg
gcagatgataatgttcactttcagcagtcagctcagatctccaaagccctggtggatgct
ggtgtggatttccaagcaatgtggtacacggatgaagaccacgggatcgctagcagcaca
gctcaccagcacatctattcccacatgagccatttcctccagcagtgcttctccttacac
tag

DBGET integrated database retrieval system