KEGG   Mus musculus (mouse): 13483
Entry
13483             CDS       T01002                                 

Gene name
Dpp6, B930011P16Rik, D5Buc3, D5Buc4, D5Buc5, DPP_VI, Dpp, Dpp-6, Gm1377, In(5)6, In(5)6H-p, Pe, Peplb, R, Rw
Definition
(RefSeq) dipeptidylpeptidase 6
  KO
K23013  dipeptidyl aminopeptidase-like protein 6
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    13483 (Dpp6)
SSDB
Motif
Pfam: DPPIV_N Peptidase_S9 PD40 DLH DUF872 Abhydrolase_3
Other DBs
NCBI-GeneID: 13483
NCBI-ProteinID: NP_034205
MGI: 94921
Ensembl: ENSMUSG00000061576
Vega: OTTMUSG00000029575
UniProt: Q9Z218
Position
5 B1; 5 12.92 cM
AA seq 804 aa
MNQTAGASNNVRCPPGKGHKELVGSNPPQRNWKGIAIALLVILVICSLIVTSVILLTPAE
DTSLSQKKKVTVEDLFSEDFKIHDPEAKWISNKEFIYRERKGSVILRNVETNNSTVLIEG
KKIESLRAIRYEISPDKEYVLFSYNVEPVYQHSHTGYYVLSKIPHGDPQSLDPPEVSNAK
LQYAGWGPKGQQLIFIFENNIYYCAHVGKQAIRVVSTGKEGVIYNGLSDWLYEEEILKSH
IAHWWSPDGTRLAYATINDSRVPLMELPTYTGSVYPTVKPYHYPKAGSENPSISLHVIGL
NGPTHDLEMMPPDDPRMREYYITMVKWATSTKVAVTWLNRAQNVSILTLCDATTGVCTKK
HEDESEAWLHRQNEEPVFSKDGRKFFFVRAIPQGGRGKFYHITVSSSQPNSSNDNIQSIT
SGDWDVTKILSYDEKRNKIYFLSTEDLPRRRHLYSANTVDDFNRQCLSCDLVENCTYVSA
SFSHNMDFFLLKCEGPGVPTVTVHNTTDKRRMFDLEANEEVQKAINDRQMPKIEYRKIEV
EDYSLPMQILKPATFTDTAHYPLLLVVDGTPGSQSVTERFEVTWETVLVSSHGAVVVKCD
GRGSGFQGTKLLQEVRRRLGFLEEKDQMEAVRTMLKEQYIDKTRVAVFGKDYGGYLSTYI
LPAKGENQGQTFTCGSALSPITDFKLYASAFSERYLGLHGLDNRAYEMTKLAHRVSALED
QQFLIIHATADEKIHFQHTAELITQLIKGKANYSLQIYPDESHYFHSVALKQHLSRSIIG
FFVECFRVQDKLPTATAKEEEEED
NT seq 2415 nt   +upstreamnt  +downstreamnt
atgaatcaaacagccggagcttccaacaacgtcaggtgtcctccagggaaaggccataag
gagctggtggggagtaatcctccacagaggaactggaaaggaatcgccattgcgctgctc
gtcatccttgtcatctgctctctgattgtcacctcagtcatcctgttgaccccagcggaa
gataccagtctgtctcagaagaaaaaagtgactgtggaagatctcttcagtgaagacttc
aaaatccatgacccagaggcaaagtggataagcaataaggaattcatctacagagaacgg
aaagggagtgtcatactgcggaatgttgaaacaaataattccacggtgttaatagaaggc
aaaaaaattgaatccttgagagccatcagatatgaaatatccccagataaagagtatgtg
ctgttctcctataatgtggagccggtataccaacactcccacactggatattatgttctg
agcaaaattcctcatggggaccctcagagtctggacccaccagaagtcagcaacgcaaag
cttcagtatgcagggtggggcccaaaaggccagcagctgatatttatctttgagaacaac
atctactactgtgcacacgttggaaagcaggcaattcgagtggtctctacagggaaggag
ggcgtgatctacaatggcctcagtgactggctgtatgaagaggagattctgaagagccac
atcgctcattggtggtcaccagatggtacaaggctcgcctatgccaccatcaacgactcc
cgggttccacttatggagctgccaacgtacacaggctctgtctaccccactgtgaagccc
taccactatcctaaggctggcagtgaaaaccccagcatctcgctccatgtcatcggcttg
aatggacccacccacgacctggagatgatgccacctgatgacccgcgcatgagggaatat
tacatcaccatggtgaaatgggccaccagcaccaaggtcgctgtgacctggctgaaccgg
gcccagaatgtgtcaatcctgaccctctgtgatgccaccacgggtgtctgcactaagaaa
catgaagatgaaagcgaagcctggctccacagacagaatgaagagcctgtgttctccaaa
gatggcaggaagtttttctttgtcagagcgatcccacagggaggccggggtaaattctac
catatcaccgtatcatcatcccagcccaacagcagcaatgacaacatccagtctatcacc
tctggagactgggatgtgaccaagatcctgtcctatgatgagaagcggaataagatctat
ttcctgagcacagaagacctgccacggagacgacatctctacagtgccaacacggtagat
gacttcaacaggcagtgtctgtcatgtgacttggtggagaactgcacctatgtcagcgct
tctttcagccataacatggacttcttcctgctcaagtgtgaaggccctggcgtacccact
gttactgtgcataacaccacggacaagagaagaatgtttgacttggaagcaaatgaggaa
gttcagaaggctatcaacgaccggcagatgccgaagattgaatatcgaaaaattgaagta
gaagattacagcttgccaatgcaaatcttgaagccggccaccttcaccgacacagctcac
taccccttattgctcgtggtggatggtaccccagggagtcagagcgtgacagagaggttt
gaggtgacctgggaaacagtgttggtgagcagccatggagccgtggtggtcaagtgtgac
ggccgaggcagcggcttccagggaaccaagctcctacaggaagtacggaggcggctaggc
ttcctggaggagaaggaccagatggaagctgtaagaactatgctgaaggagcagtatatt
gacaagactcgggtagctgtgtttgggaaggattatggtgggtacctgagcacttacatc
ctcccagccaagggagaaaatcaaggtcagactttcacctgcggctctgcgctctctcca
ataacagacttcaaactctatgcctctgcattttctgagaggtaccttggcctccatgga
ctcgacaacagagcgtatgagatgaccaagctggcacaccgagtgtcagcactggaggac
cagcagttcctgatcatccacgccacggccgatgaaaaaatccatttccagcacacagct
gagctcatcacgcagctgatcaagggaaaggccaattacagcttacagatctacccagat
gagagtcactacttccacagcgtggcgctcaagcagcacctgtccaggtccatcatcggc
ttctttgtggaatgtttcagagtccaagataagctaccaacagccacagcaaaagaggag
gaggaggaggactaa

DBGET integrated database retrieval system