KEGG   Mus musculus (mouse): 13489Help
Entry
13489             CDS       T01002                                 

Gene name
Drd2, D2R, Drd-2
Definition
(RefSeq) dopamine receptor D2
  KO
K04145  dopamine receptor D2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04015  Rap1 signaling pathway
mmu04024  cAMP signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04540  Gap junction
mmu04728  Dopaminergic synapse
mmu05012  Parkinson disease
mmu05030  Cocaine addiction
mmu05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    13489 (Drd2)
   04024 cAMP signaling pathway
    13489 (Drd2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    13489 (Drd2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    13489 (Drd2)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    13489 (Drd2)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05012 Parkinson disease
    13489 (Drd2)
  09165 Substance dependence
   05030 Cocaine addiction
    13489 (Drd2)
   05034 Alcoholism
    13489 (Drd2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    13489 (Drd2)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Biogenic amine
   Dopamine
    13489 (Drd2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srv 7tm_4 RIFIN
Motif
Other DBs
NCBI-GeneID: 13489
NCBI-ProteinID: NP_034207
MGI: 94924
Ensembl: ENSMUSG00000032259
Vega: OTTMUSG00000063016
UniProt: P61168
Position
9 A5.3; 9 26.72 cM
AA seq 444 aa AA seqDB search
MDPLNLSWYDDDLERQNWSRPFNGSEGKPDRPHYNYYAMLLTLLIFIIVFGNVLVCMAVS
REKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTA
SILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMIAIVWVLSFTISCPLLFGLNNTDQN
ECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRKRRKRVNTKRSSRAFRANLKTPL
KGNCTHPEDMKLCTVIMKSNGSFPVNRRRMDAARRAQELEMEMLSSTSPPERTRYSPIPP
SHHQLTLPDPSHHGLHSNPDSPAKPEKNGHAKIVNPRIAKFFEIQTMPNGKTRTSLKTMS
RRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNS
AVNPIIYTTFNIEFRKAFMKILHC
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggatccactgaacctgtcctggtacgatgatgatctggagaggcagaactggagccgg
cccttcaatgggtccgaagggaagccagacaggccccactacaactactatgccatgctg
ctcaccctcctcatctttatcatcgtctttggcaatgtgctggtgtgcatggctgtatcc
agagagaaggctttgcagaccaccaccaactacctgatagtcagcctcgctgtggccgat
cttctggtggccacactggttatgccctgggtcgtctatctggaggtggtgggtgagtgg
aaattcagcaggattcactgtgacatctttgtcactctggatgtcatgatgtgcacagca
agcatcttgaacctgtgtgccatcagcatcgacaggtacacagctgtggccatgcctatg
ttgtataacacacgctacagctccaagcgccgagttactgtcatgatcgccattgtctgg
gtcctgtccttcaccatctcttgcccactgctctttggactcaacaacacagaccagaat
gagtgtatcattgccaaccctgccttcgtggtctactcctccatcgtctcgttctacgtg
cccttcatcgtcaccctgctggtctatatcaaaatctacatcgttctccgcaagcgtcgg
aagcgggtcaacaccaagcgtagcagccgagctttcagagccaacctgaagacaccactc
aagggcaactgtacccaccctgaggacatgaaactctgcaccgttatcatgaagtctaat
gggagtttcccagtgaacaggcggagaatggatgctgcccgccgagctcaggagctggaa
atggagatgctgtcaagcaccagccccccagagaggacccggtatagccccatccctccc
agtcaccaccagctcactctccccgatccatcccaccacggtctacatagcaaccctgac
agtcctgccaaaccagaaaagaatgggcatgccaagattgtcaatcccaggattgccaag
ttctttgagatccagaccatgcccaatggcaaaacccggacctcccttaagacgatgagc
cgcaggaagctctcccagcagaaggagaagaaagccactcagatgcttgccattgttctt
ggtgtgttcatcatctgctggctgcccttcttcatcacgcacatcctgaatatacactgt
gactgcaacatcccaccagtcctctacagcgccttcacatggctgggctatgtcaacagt
gccgtgaaccccatcatctataccaccttcaacattgagttccgcaaggccttcatgaag
atcctgcactgctga

DBGET integrated database retrieval system