KEGG   Mus musculus (house mouse): 13491
Entry
13491             CDS       T01002                                 
Symbol
Drd4, AW125663, D4R, Drd-4
Name
(RefSeq) dopamine receptor D4
  KO
K04147  dopamine receptor D4
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04728  Dopaminergic synapse
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    13491 (Drd4)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    13491 (Drd4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    13491 (Drd4)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Biogenic amine
   Dopamine
    13491 (Drd4)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 13491
NCBI-ProteinID: NP_031904
MGI: 94926
Ensembl: ENSMUSG00000025496
UniProt: P51436
Structure
Position
7:140871887..140876377
AA seq 387 aa
MGNSSATEDGGLLAGRGPESLGTGAGLGGAGAAALVGGVLLIGLVLAGNSLVCVSVASER
TLQTPTNYFIVSLAAADLLLAVLVLPLFVYSEVQGGVWLLSPRLCDTLMAMDVMLCTASI
FNLCAISVDRFVAVTVPLRYNQQGQCQLLLIAATWLLSAAVASPVVCGLNDVPGRDPAVC
CLENRDYVVYSSVCSFFLPCPLMLLLYWATFRGLRRWEAARHTKLHSRAPRRPSGPGPPV
SDPTQGPFFPDCPPPLPSLRTSPSDSSRPESELSQRPCSPGCLLADAALPQPPEPSSRRR
RGAKITGRERKAMRVLPVVVGAFLVCWTPFFVVHITRALCPACFVSPRLVSAVTWLGYVN
SALNPIIYTIFNAEFRSVFRKTLRLRC
NT seq 1164 nt   +upstreamnt  +downstreamnt
atggggaacagcagcgctactgaggacggtgggctgttggccgggcgtgggccagaatcc
ctggggactggcgccgggcttgggggcgcgggcgcggcggcgctggtggggggcgtgctg
ctcatcggcttggtgttggcagggaactcgctcgtgtgcgtgagcgtggcctccgagcgc
acgctgcagacacccaccaactacttcatcgtgagcctggctgctgccgacctcctcctc
gcggtgctggtgctgcctctctttgtctactccgaggtccagggtggcgtgtggctcctg
agcccccgtctctgtgacacgctcatggccatggacgtcatgctgtgcaccgcctccatc
ttcaacctgtgcgccatcagcgtggacaggttcgtggccgtgaccgtgccgctgcgctac
aaccagcagggtcagtgccagctgctgctcatcgccgccacgtggctgctgtccgccgcg
gtggcttcgccagtggtgtgtggcctcaatgatgtgcccggccgcgatccggccgtgtgc
tgcctggagaaccgagactatgtggtctactcgtccgtctgctccttcttcctgccctgt
ccgctcatgctactgctttactgggccactttccgcggcctgcggcgctgggaggcagcc
cggcacaccaaacttcacagccgcgcgccgcgccgacccagcggccccggcccgccggtg
tcggaccctactcagggtcccttcttcccagactgcccacctcccttacccagcctccgg
acgagccccagcgactccagcaggccggagtcagagctctctcagagaccctgcagcccc
gggtgtctgctcgctgatgcagctctcccgcaacctcctgagccgtcttcccgcagaagg
agaggcgccaagatcacgggaagggagcgcaaggcaatgagagtcctgccggtggtagtc
ggggccttcctggtgtgttggacgcctttcttcgtggtgcacatcacgcgggcgctgtgt
ccggcttgcttcgtgtctccgcgcctggtcagtgccgtcacctggctaggctatgtcaac
agtgccctcaaccccatcatctacaccatcttcaacgcggagtttcgaagtgtcttccgc
aagactctccgtctccgctgctga

DBGET integrated database retrieval system