KEGG   Mus musculus (mouse): 13506
Entry
13506             CDS       T01002                                 

Symbol
Dsc2, AW228162, Dsc
Name
(RefSeq) desmocollin 2
  KO
K07601  desmocollin 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    13506 (Dsc2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    13506 (Dsc2)
   04515 Cell adhesion molecules [BR:mmu04515]
    13506 (Dsc2)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   13506 (Dsc2)
Cell adhesion molecules [BR:mmu04515]
 Cadherins
  Major cadherins
   13506 (Dsc2)
SSDB
Motif
Pfam: Cadherin Cadherin_pro Cadherin_C Cadherin_3 RibLong Cadherin_4
Other DBs
NCBI-GeneID: 13506
NCBI-ProteinID: NP_001304294
MGI: 103221
Ensembl: ENSMUSG00000024331
Vega: OTTMUSG00000026419
UniProt: P55292 Q544V1
Position
18 A2; 18 11.14 cM
AA seq 902 aa
MAAVGSMRSGSPAFGLGHLLTLAILALASDACKEVVLQVPSELPAEKFVGRVNLMDCLKS
ADIVHLSDPDFQVLEDGSVYTTSSVVLSSGQRSFTIWLFSTDSQEEREISVHLEGPVEVL
NKRPHTEKVLSRAKRRWAPIPCSMLENSLGPFPLFLQQIQSDTAQNYTIYYSIRGPGVDK
EPLNLFYVERDTGNLYCTGRVDREQYESFELTAFATTPDGYTPEYPLPLLIKIEDENDNY
PIFTQKLYSFTVQENSRIGSIVGEVCATDLDEPDTMHTRLRYSILEQSPSPPMLFTMHPS
TGVITTTSAQLDRELIDKYQLLIKVQDMDGQYFGLHTTAKCIITIEDVNDNLPTFTRTTY
VTSVEENTVNVEILRLTVQDKDLVNSPNWRANYTILKGNENGNFKIVTDPKTNEGILCVI
KPLDYEERQQVTLQIGVVNEAPYTREASSKSPMSTATVTVTVTNQDEGPECIPPMQTVRI
QENVPVGTRNDGYKAYDPETRSSSGIRYRKLSDPRGWVTVNEDSGSITIFRALDREAETV
RNGIYNITVLALDADGRSCTGTLGIILEDVNDNGPFIPKQTVVICKATMSSAEIVAVDLD
DPVNGPPFDFSLESSDSEVQRMWRLTRINDTAARLSYQNDPSFGSYAVPIRVTDRLGLSS
VTTLNVLVCDCITESDCTLRSGERTGYADVRLGPWAILAILLGIALLFCILFTLVCSVSR
ASKQQKILPDDLAQQNLIVSNTEAPGDDKVYSTNGLTTQTMGASGQTAFTTMGTGVKSGG
QETIEMVKGGQQTLDSRRGAGYHHHTLDPCRGGHVEVDNYRHTYSEWYNFIQPRLGDKVQ
FCHTDDNQKLAQDYVLTYNYEGKGSAAGSVGCCSDLQEEDGLEFLDHLEPKFRTLAEVCA
KR
NT seq 2709 nt   +upstreamnt  +downstreamnt
atggcggctgtgggatctatgcgctccgggagccctgccttcggcctgggacacctgttg
acccttgcgatccttgcacttgcctctgatgcctgtaaagaagtcgtcctccaggtcccc
tctgaactacctgccgagaaatttgttggcagagtgaacctgatggactgccttaaatca
gcagacatagttcatctgagtgatcctgacttccaagtcttagaagatggttctgtgtac
acaaccagttctgttgttttgtcctcggggcaaagaagctttactatatggctttttagc
acagacagccaagaagaaagggagatatctgtccatttagagggcccagtagaggtacta
aataaaagaccgcatacagagaaggttctcagccgtgccaagagaagatgggctcctatc
ccttgttccatgctagagaattcattgggtcccttcccacttttccttcaacagatccag
tctgacacagctcaaaactataccatatactattccatcagaggtccaggagttgataaa
gaacctctaaacttattttatgtggaaagagatactggaaacctgtattgcactggtcgt
gtagatcgtgagcagtatgagtcctttgagctgactgcatttgcaacaactccagatggg
tatacgccagagtacccactgccgctcctcattaaaatagaggacgagaacgataattac
ccgatctttacacagaaactgtacagcttcacagttcaggaaaatagtcgcattggttct
attgtgggggaggtctgtgcaaccgacctggatgagccagacacaatgcacactcgcctg
aggtactccatcctggagcagtcgccttctccacccatgctatttactatgcatcccagc
actggtgtgatcactaccacgtcggctcagctggacagagagttaattgacaagtaccag
ttgctaataaaagtccaggatatggatggccagtattttggtttgcacacaacagcaaag
tgcatcattactattgaagatgtgaatgacaacctgcccacgttcactcgcactacgtat
gtgacatcagtggaagaaaatacagttaatgtggaaatcttgcgacttactgttcaggat
aaagatttagttaactcacctaattggagagctaattacaccattttgaagggcaatgaa
aatggaaattttaaaatcgtaacagatcctaaaaccaatgaaggcattctgtgtgtgatt
aagcctctggactatgaagaacggcaacaggtgaccctgcaaattggagtagttaatgaa
gctccatacactagagaggctagctcaaagtcacccatgagcacagccacagtgactgtc
accgtgacaaatcaggatgagggccccgagtgtatccctccaatgcaaactgtgaggatt
caagaaaatgtaccagttgggactagaaatgatggatataaggcatatgacccagagacc
agaagcagcagtggcataaggtacagaaagttaagtgacccaagagggtgggtcactgtt
aatgaagattcaggatcgatcactattttccgagcgttggatcgagaggctgagactgtc
agaaatggcatttacaatattacagtccttgcgttagatgcagatgggagaagctgtact
ggaactctgggaatcatacttgaagatgtgaatgataatggcccattcatacccaagcag
acagtggtgatatgcaaggctaccatgtcctctgctgaaattgttgcagttgatctcgat
gatccagtgaatggcccaccatttgatttcagtttggagagctctgattcggaagttcag
aggatgtggaggctaacaagaatcaatgatacagcagctcgtctttcctatcagaacgac
ccttcatttggatcctatgcagttcccattcgagttacagacagacttggtctgtcctca
gtaaccacattgaatgtccttgtatgtgactgcattactgaaagtgactgcacactccgc
tctggagaaaggactggctatgctgatgtgagacttggaccatgggccatccttgctata
ctgttgggcatagccttgctattttgtatcctgtttacattagtctgtagtgtttcccgg
gcatcaaaacaacagaaaattcttcctgatgacttagctcaacagaacctaattgtatca
aacaccgaggctcctggagatgacaaagtttattccacaaacggcttgacaactcaaact
atgggagcttctgggcagacagctttcaccaccatgggaactggagtcaaaagtggaggg
caagagaccattgagatggtaaaaggagggcagcagactttggactcacgcagaggggct
ggctatcatcaccataccctggatccttgcaggggaggacatgtggaggtggacaactac
agacacacttactcagagtggtacaatttcattcagccccgacttggtgataaggtacag
ttttgccatacggatgacaaccagaagcttgctcaagactacgtcctcacatacaactat
gagggaaaaggctcggctgctggctctgtgggttgctgtagtgacctacaggaagaagac
gggcttgagtttttggaccatctggagcccaaatttaggacattggcagaagtatgtgca
aagaggtga

DBGET integrated database retrieval system