KEGG   Mus musculus (mouse): 13510Help
Entry
13510             CDS       T01002                                 

Gene name
Dsg1a, DG1, DGI, Dsg1, dsg1-alpha
Definition
(RefSeq) desmoglein 1 alpha
  KO
K07596  desmoglein 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    13510 (Dsg1a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mmu04515]
    13510 (Dsg1a)
Cell adhesion molecules [BR:mmu04515]
 Cadherins
  Major cadherins
   13510 (Dsg1a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cadherin Cadherin_C Cadherin_3
Motif
Other DBs
NCBI-GeneID: 13510
NCBI-ProteinID: NP_034209
MGI: 94930
Ensembl: ENSMUSG00000069441
Vega: OTTMUSG00000016312
UniProt: Q61495
Position
18 A2; 18 11.29 cM
AA seq 1057 aa AA seqDB search
MDWHSFRIAALLLTSLVVLEVNSEFQIQVRDHNAKNGTIKWHSIRRQKREWIKFAAACRE
GEDNSKRNPIAKIHSDCAANQPVTYRISGVGIDQPPYGIFIINQKTGEINITSIVDREVT
PFFIIYCRALNAQGQDLENPLELRVRVMDINDNPPVFSMTTFLGQIEENSNANTLVMKLN
ATDADEPNNLNSMIAFKIIRQEPSDSPMFIINRKTGEIRTMNNFLDREQYSQYSLVVRGS
DRDGGADGMSAESECSITILDVNDNIPYLEQSSYDITIEENALHSQLVQIRVIDLDEEFS
DNWKAIIFFISGNEGNWFEIEMNERTNVGTLKVVKPLDYEAMKNLQLSIGVRNVAEFHQS
IISQYRLTATMVTVTVLNVIEGSVFRPGSKTFVVDSRMEANHRVGEFVATDLDTGRASTN
VRYEMGNNPENLLVVDSRTGIITLRNRVTMEQYQRLNGEYKGTVLSIDDSLQRTCTGTIV
IELSGTGWVTGSESGGSSSGSGDDRDRVTNGYQGTSSTENPQRVTGSWGGSGIDGTRPNT
NPFQGDPDETLETPLYGDNVHFGPAGIGLLIMGFLVLGLVPFLLICCDCGGAPGGGAGFE
PVPECSDGAIHTWAVEGPQPEPHEGITTICVPQMPPGNANVIEYIDNSGVYTNEYCGREM
QDLGGGERTTGFELMDGVKTSAAPEICQEYSGTLRRNSMRECRDGGLNMNFMESYFCQKA
YAYADEDEGRPSNDCLLIYDIEGVGSPAGSVGCCSFIGEDLDESFLDTLGPKFKKLADIS
LGKEIDSYPDSDPSWPPQSTEPMCPQHTEPLGSGHPPISPHFGTTTVISENAYHSGPGVQ
HPVPIPDPLGYGNVTVRESYTTSGTLKPSVHFHDNQQASNVVVTERVVGPISGADLHGML
EIPDLRGGANVIVTERVIAPGSSLPTSLTIPNPQETSNVVVTERVIQPTSGMIGNLSMTP
ELSSAHNVIVTERVVSGAGMSEIAGTAGLGGVGGIGSSGLVSTTMGASGTGLNMGGTATI
GHMRSSSDHHFSQTVGSASPSMARSRITKYNTVQYSK
NT seq 3174 nt NT seq  +upstreamnt  +downstreamnt
atggactggcactccttcaggatagctgccctgctgctcacttccctggtggtgcttgaa
gttaacagtgaatttcaaatccaggtaagagatcataacgccaaaaatggtaccatcaag
tggcattccatcagaaggcagaaacgagaatggatcaagtttgctgcagcctgtcgcgaa
ggtgaagacaactcaaagagaaacccaattgccaaaattcattcagattgtgctgcaaat
caaccagtgacataccgcatctcgggagtgggaattgaccagccaccttatggaatcttc
attattaatcaaaaaactggtgaaatcaatataacatccattgttgatcgtgaagtcacc
ccctttttcattatctactgccgagcactgaatgcacaaggtcaagacttggagaatcca
ctggagcttagagttagagtgatggatataaatgacaaccctcctgtgttttcaatgact
acatttctaggacaaatagaagaaaattctaatgcaaacacactggtaatgaaactcaat
gctaccgatgccgatgagccaaataacttgaactcaatgatagccttcaagatcataaga
caggagccttctgactcaccaatgttcatcatcaacaggaaaactggagaaatcagaaca
atgaataactttctagacagagagcaatatagccagtattcccttgtggtgagaggctca
gaccgggacggtggagcagacggcatgtctgcagagagcgagtgcagcatcaccatcctg
gatgtcaatgacaacatcccatacttggagcagtcatcttatgacatcacaattgaagaa
aatgcacttcactcacagctagtgcagatcagagtcattgatttggatgaagaattctca
gacaactggaaggcaatcattttctttatctctggaaatgagggaaattggtttgaaata
gaaatgaatgaaagaacaaatgtaggaactctgaaggttgtcaagcccctagattatgaa
gccatgaagaatctacagcttagtattggtgttcggaatgtagctgaattccaccagtca
attatttctcaatacagactcacagcaactatggtcactgtgactgtgttaaatgtcatc
gagggctctgtgttccgtccaggttcaaagacatttgtagtagacagtagaatggaagca
aatcacagagtgggagagtttgtagctacagacctggacacaggtcgagcttccacaaat
gttagatatgaaatgggaaataacccagagaacctgctggttgttgactcaagaacaggc
ataataacgttaagaaacagagttactatggaacaataccaaaggcttaatggggaatat
aaaggaacagtgctatcaatagatgattcccttcagaggacctgcacggggacaatcgtc
attgaacttagtggcactggctgggtaactggttcagaaagtggtggcagttccagtggc
agtggcgatgatcgtgaccgagtgactaatggatatcaaggcacttcttccactgagaac
ccacaacgcgtcacaggatcatggggaggcagcggcatcgatggcactcgccctaacact
aaccctttccaaggggatcctgatgaaacccttgagacccctctctatggagacaacgtt
cacttcggtcctgcaggcatcgggctgctcatcatggggttcctagtcttaggattggtt
ccattcctgctgatctgctgtgattgtggaggggcccctggtggtggagctggatttgaa
cctgttccagaatgttctgatggagcaattcacacgtgggctgtagaagggccacagcct
gaaccccatgaagggataaccaccatctgtgtgccacaaatgccacctggtaatgccaat
gttatagaatatattgacaactcaggagtttatacaaatgaatattgtggcagagaaatg
caagatctgggaggaggagaaagaaccacaggatttgaactaatggatggagttaaaaca
tcagctgcacctgagatatgccaagaatattcaggaacattaagaagaaattcaatgaga
gaatgtagagatgggggtctcaacatgaatttcatggaaagttacttctgccagaaagcc
tatgcttatgcggatgaagatgaaggacgtccatccaatgactgtttgctcatctatgac
atcgaaggtgtgggttcccctgcaggctccgtgggctgttgcagtttcattggagaagat
ctagatgagagcttcctggataccttggggcccaagtttaagaagttggcagatatcagc
ctgggaaaagaaatagactcatacccagattctgatccttcttggcctcctcagagcact
gaaccgatgtgtccccagcatacagagcccctgggtagtggacacccacccatctcccca
cattttggcacgaccacagtaatttctgaaaatgcctaccactctggacctggagtacag
catcctgtaccaattcctgatcctctgggctatggcaatgtcactgtgagggagtcctat
accacctctggcactctgaaaccctctgtccactttcatgataatcagcaggcttcaaat
gtggtggtgacagagagggtggtgggccccatctctggtgctgatttgcatggcatgtta
gagatacctgacttaagaggtggagcaaatgttatagtgacagaaagggtaatagcacca
ggctcaagtctacccacttctctaaccattcctaaccctcaagagacctcaaatgtagtt
gtgacagaaagagtgatccaaccaacctctggcatgataggcaatctgagcatgacccct
gaattatcaagtgcccacaacgtgattgtgacagagagagtggtttctggtgctggtatg
agtgaaattgcaggcactgccggattagggggggttggaggcataggcagcagtggcctt
gttagcaccaccatgggtgcttctggcactgggctgaacatgggaggaacagccactatt
ggccacatgaggagctcctctgaccatcactttagtcagacagttggatctgcctccccc
agcatggctcgaagtcgaatcacaaagtacaatacggtacagtatagcaagtag

DBGET integrated database retrieval system