KEGG   Mus musculus (mouse): 13510
Entry
13510             CDS       T01002                                 

Gene name
Dsg1a, DG1, DGI, Dsg, Dsg1, dsg1-alpha
Definition
(RefSeq) desmoglein 1 alpha
  KO
K07596  desmoglein 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    13510 (Dsg1a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mmu04515]
    13510 (Dsg1a)
Cell adhesion molecules [BR:mmu04515]
 Cadherins
  Major cadherins
   13510 (Dsg1a)
SSDB
Motif
Pfam: Cadherin Cadherin_C Cadherin_3
Other DBs
NCBI-GeneID: 13510
NCBI-ProteinID: NP_034209
MGI: 94930
Ensembl: ENSMUSG00000069441
Vega: OTTMUSG00000016312
UniProt: Q61495
Position
18 A2; 18 11.29 cM
AA seq 1057 aa
MDWHSFRIAALLLTSLVVLEVNSEFQIQVRDHNAKNGTIKWHSIRRQKREWIKFAAACRE
GEDNSKRNPIAKIHSDCAANQPVTYRISGVGIDQPPYGIFIINQKTGEINITSIVDREVT
PFFIIYCRALNAQGQDLENPLELRVRVMDINDNPPVFSMTTFLGQIEENSNANTLVMKLN
ATDADEPNNLNSMIAFKIIRQEPSDSPMFIINRKTGEIRTMNNFLDREQYSQYSLVVRGS
DRDGGADGMSAESECSITILDVNDNIPYLEQSSYDITIEENALHSQLVQIRVIDLDEEFS
DNWKAIIFFISGNEGNWFEIEMNERTNVGTLKVVKPLDYEAMKNLQLSIGVRNVAEFHQS
IISQYRLTATMVTVTVLNVIEGSVFRPGSKTFVVDSRMEANHRVGEFVATDLDTGRASTN
VRYEMGNNPENLLVVDSRTGIITLRNRVTMEQYQRLNGEYKGTVLSIDDSLQRTCTGTIV
IELSGTGWVTGSESGGSSSGSGDDRDRVTNGYQGTSSTENPQRVTGSWGGSGIDGTRPNT
NPFQGDPDETLETPLYGDNVHFGPAGIGLLIMGFLVLGLVPFLLICCDCGGAPGGGAGFE
PVPECSDGAIHTWAVEGPQPEPHEGITTICVPQMPPGNANVIEYIDNSGVYTNEYCGREM
QDLGGGERTTGFELMDGVKTSAAPEICQEYSGTLRRNSMRECRDGGLNMNFMESYFCQKA
YAYADEDEGRPSNDCLLIYDIEGVGSPAGSVGCCSFIGEDLDESFLDTLGPKFKKLADIS
LGKEIDSYPDSDPSWPPQSTEPMCPQHTEPLGSGHPPISPHFGTTTVISENAYHSGPGVQ
HPVPIPDPLGYGNVTVRESYTTSGTLKPSVHFHDNQQASNVVVTERVVGPISGADLHGML
EIPDLRGGANVIVTERVIAPGSSLPTSLTIPNPQETSNVVVTERVIQPTSGMIGNLSMTP
ELSSAHNVIVTERVVSGAGMSEIAGTAGLGGVGGIGSSGLVSTTMGASGTGLNMGGTATI
GHMRSSSDHHFSQTVGSASPSMARSRITKYNTVQYSK
NT seq 3174 nt   +upstreamnt  +downstreamnt
atggactggcactccttcaggatagctgccctgctgctcacttccctggtggtgcttgaa
gttaacagtgaatttcaaatccaggtaagagatcataacgccaaaaatggtaccatcaag
tggcattccatcagaaggcagaaacgagaatggatcaagtttgctgcagcctgtcgcgaa
ggtgaagacaactcaaagagaaacccaattgccaaaattcattcagattgtgctgcaaat
caaccagtgacataccgcatctcgggagtgggaattgaccagccaccttatggaatcttc
attattaatcaaaaaactggtgaaatcaatataacatccattgttgatcgtgaagtcacc
ccctttttcattatctactgccgagcactgaatgcacaaggtcaagacttggagaatcca
ctggagcttagagttagagtgatggatataaatgacaaccctcctgtgttttcaatgact
acatttctaggacaaatagaagaaaattctaatgcaaacacactggtaatgaaactcaat
gctaccgatgccgatgagccaaataacttgaactcaatgatagccttcaagatcataaga
caggagccttctgactcaccaatgttcatcatcaacaggaaaactggagaaatcagaaca
atgaataactttctagacagagagcaatatagccagtattcccttgtggtgagaggctca
gaccgggacggtggagcagacggcatgtctgcagagagcgagtgcagcatcaccatcctg
gatgtcaatgacaacatcccatacttggagcagtcatcttatgacatcacaattgaagaa
aatgcacttcactcacagctagtgcagatcagagtcattgatttggatgaagaattctca
gacaactggaaggcaatcattttctttatctctggaaatgagggaaattggtttgaaata
gaaatgaatgaaagaacaaatgtaggaactctgaaggttgtcaagcccctagattatgaa
gccatgaagaatctacagcttagtattggtgttcggaatgtagctgaattccaccagtca
attatttctcaatacagactcacagcaactatggtcactgtgactgtgttaaatgtcatc
gagggctctgtgttccgtccaggttcaaagacatttgtagtagacagtagaatggaagca
aatcacagagtgggagagtttgtagctacagacctggacacaggtcgagcttccacaaat
gttagatatgaaatgggaaataacccagagaacctgctggttgttgactcaagaacaggc
ataataacgttaagaaacagagttactatggaacaataccaaaggcttaatggggaatat
aaaggaacagtgctatcaatagatgattcccttcagaggacctgcacggggacaatcgtc
attgaacttagtggcactggctgggtaactggttcagaaagtggtggcagttccagtggc
agtggcgatgatcgtgaccgagtgactaatggatatcaaggcacttcttccactgagaac
ccacaacgcgtcacaggatcatggggaggcagcggcatcgatggcactcgccctaacact
aaccctttccaaggggatcctgatgaaacccttgagacccctctctatggagacaacgtt
cacttcggtcctgcaggcatcgggctgctcatcatggggttcctagtcttaggattggtt
ccattcctgctgatctgctgtgattgtggaggggcccctggtggtggagctggatttgaa
cctgttccagaatgttctgatggagcaattcacacgtgggctgtagaagggccacagcct
gaaccccatgaagggataaccaccatctgtgtgccacaaatgccacctggtaatgccaat
gttatagaatatattgacaactcaggagtttatacaaatgaatattgtggcagagaaatg
caagatctgggaggaggagaaagaaccacaggatttgaactaatggatggagttaaaaca
tcagctgcacctgagatatgccaagaatattcaggaacattaagaagaaattcaatgaga
gaatgtagagatgggggtctcaacatgaatttcatggaaagttacttctgccagaaagcc
tatgcttatgcggatgaagatgaaggacgtccatccaatgactgtttgctcatctatgac
atcgaaggtgtgggttcccctgcaggctccgtgggctgttgcagtttcattggagaagat
ctagatgagagcttcctggataccttggggcccaagtttaagaagttggcagatatcagc
ctgggaaaagaaatagactcatacccagattctgatccttcttggcctcctcagagcact
gaaccgatgtgtccccagcatacagagcccctgggtagtggacacccacccatctcccca
cattttggcacgaccacagtaatttctgaaaatgcctaccactctggacctggagtacag
catcctgtaccaattcctgatcctctgggctatggcaatgtcactgtgagggagtcctat
accacctctggcactctgaaaccctctgtccactttcatgataatcagcaggcttcaaat
gtggtggtgacagagagggtggtgggccccatctctggtgctgatttgcatggcatgtta
gagatacctgacttaagaggtggagcaaatgttatagtgacagaaagggtaatagcacca
ggctcaagtctacccacttctctaaccattcctaaccctcaagagacctcaaatgtagtt
gtgacagaaagagtgatccaaccaacctctggcatgataggcaatctgagcatgacccct
gaattatcaagtgcccacaacgtgattgtgacagagagagtggtttctggtgctggtatg
agtgaaattgcaggcactgccggattagggggggttggaggcataggcagcagtggcctt
gttagcaccaccatgggtgcttctggcactgggctgaacatgggaggaacagccactatt
ggccacatgaggagctcctctgaccatcactttagtcagacagttggatctgcctccccc
agcatggctcgaagtcgaatcacaaagtacaatacggtacagtatagcaagtag

KEGG   Mus musculus (mouse): 211924
Entry
211924            CDS       T01002                                 

Gene name
Dsg1c, Dsg, Dsg1gamma, Dsg6, dsg1g
Definition
(RefSeq) desmoglein 1 gamma
  KO
K07596  desmoglein 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    211924 (Dsg1c)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mmu04515]
    211924 (Dsg1c)
Cell adhesion molecules [BR:mmu04515]
 Cadherins
  Major cadherins
   211924 (Dsg1c)
SSDB
Motif
Pfam: Cadherin Cadherin_C Cadherin_3
Other DBs
NCBI-GeneID: 211924
NCBI-ProteinID: NP_859008
MGI: 2664358
Ensembl: ENSMUSG00000034774
Vega: OTTMUSG00000028137
UniProt: Q7TSF0
Position
18 A2; 18 11.26 cM
AA seq 911 aa
MDWHSFRIAALLLTSLVVLEVNSEFQIQVRDHNAKNGTIKWHSIRRQKREWIKFAAACRE
GEDNSKRNPIAKIHSDCAANQPVTYRISGVGIDQPPYGIFIINQKTGEINITSIVDREVT
PFFIIYCRALNAQGQDLENPLELRVRVMDINDNPPVFSMTTFLGQIEENSNANTLVMKLN
ATDADEPNNLNSMIAFKIIRQEPSDSPMFTINRKTGEIRTMNNFLDREQYSQYSLVVRGS
DRDGGADGMSAESECSITILDVNDNIPYLEQSSYDITIEENTLHSQLLQIRVIDLDEEFS
DNWKAIIFFISGNEGNWFEIEMNERTNVGTLKVVKPLDYEAVKNLQLCIGVRNVAEFHQS
IISQYRLTVTLITVTVLNVVKGCVFQPGSKTFIVDSRMEANHTVGEFLATDCETGQATNK
FKNVRYRYVMGNNPENLLVVDSGIITLRNRVTMEQYERLNKRYEGTVLSIHDSLQRTCTG
TIIMVLCGFWTTTEHPTTSTEKPVTLSITPNVDNVHFGPAGIGLLIMGFLVLGLVPFLLI
SCDCGGAPGGGAGFEPVPECSDGAIHTWAVEGPQPGGITTICVPQMPPGNANVIEYIDNS
GVYTNEYCGREMQDLGGGERTTGFELMDGVKTSAAPEICQEYSGTLRRNSMRECRDGGLN
MNFMESYFCQKAYAYADEDEGRPSNDCLLIYDIEGVGSPAGSVGCCSFIEDLDESFLDTL
GPKFKKLADISLGKEIDSYPDPDPSWPPQSTEPICPQHMEQLASGHPSISPHFGKTTVIS
ENAYPSGPGVQHPMLIPDPLGYGNITVRESYTTSGTLKPSVHFHDNQQASNVVVTERVVG
PISGADLHGMLEIPALRDGTNVIVTERVIAPGSSLPNSLTIPNPRETSNVVVTERVIQPT
SGMIGNLSIPP
NT seq 2736 nt   +upstreamnt  +downstreamnt
atggactggcactccttcaggatagctgccctgctgctcacttccctggtggtgcttgaa
gttaacagtgaatttcaaatccaggtaagagatcataacgccaaaaatggtaccatcaag
tggcattccatcagaaggcagaaacgagaatggatcaagtttgctgcagcctgtcgcgaa
ggtgaagacaactcaaagagaaacccaattgccaaaattcattcagactgtgctgcaaac
caaccagtgacataccgcatctcgggagtgggaattgaccagccaccttatggaatcttc
attattaaccaaaaaactggtgaaatcaatataacatccattgttgatcgtgaagtcacc
ccctttttcattatctattgccgagcactgaatgcacaaggtcaagacttggagaatcca
ctggagcttagagttagagtgatggatataaacgacaaccctcctgtgttttcaatgact
acatttctaggacaaatagaagaaaattctaatgcaaacacactggtaatgaaactcaat
gctaccgatgccgatgagccaaataacttgaactcaatgatagccttcaagatcataaga
caggagccttctgactcaccaatgttcaccatcaacaggaaaactggagaaatcagaaca
atgaataactttctagacagagagcaatatagccagtattcccttgtggtgagaggctca
gaccgggacggtggagcagacggcatgtctgcagagagcgagtgcagcatcaccatcctg
gatgtcaatgacaacatcccatacttggagcagtcatcttatgacatcacaattgaagaa
aacacacttcactcccaactattgcagatcagagtcattgatttggatgaagaattctca
gacaactggaaggcaatcattttctttatctctggaaatgagggaaattggtttgaaata
gaaatgaatgaaagaacaaatgtaggaactctgaaggttgtcaagcccctagattatgaa
gccgtgaagaatctacagctttgtattggtgttcgaaatgtagctgaattccaccagtca
attatttctcaatatagactcacagtaactttgatcactgtgactgtgttaaatgttgtc
aagggctgtgtgttccagccaggttcaaagacatttatagtagacagtagaatggaagca
aatcacacagtgggagagtttttagctacagactgtgaaacaggtcaagctacaaacaag
ttcaaaaatgttagatacagatatgtaatgggaaataacccagagaacctgctggttgtt
gactcaggcataataactttaagaaacagagttactatggaacaatacgaaaggcttaat
aagagatatgaaggaacagtgctatcaatacatgattcccttcagaggacctgcacaggg
acaatcatcatggtactttgtggcttctggacaactactgaacatcccacaacatccact
gagaaacctgtgactctatccatcactccaaacgtagacaatgttcacttcggtcctgca
ggcatcgggctgctcatcatggggttcctagtcttaggattggttccattcctgctgatc
tcctgtgattgtggaggggcccctggtggtggagctggatttgaacctgttccagaatgt
tctgatggagcaattcacacgtgggctgtagaagggccacagcctggtgggataaccacc
atctgtgtgccacaaatgccacctggtaatgccaatgttatagaatatattgacaactca
ggagtttatacaaatgaatattgtggcagagaaatgcaagatctgggaggaggagaacga
accacaggatttgaactaatggatggagttaaaacatcagctgcacctgagatatgccaa
gaatattcaggaacattaagaagaaattcaatgagagaatgtagagatgggggtctcaac
atgaattttatggaaagttacttctgccagaaagcctatgcttatgcggatgaagatgaa
ggacgtccatccaatgactgtttgctcatctatgacatcgaaggtgtgggttcccctgca
ggctccgtgggctgttgcagtttcattgaagatctagatgagagtttcctggataccttg
gggcccaagtttaagaagttggcagatatcagcctgggaaaagaaatagactcataccca
gatcctgatccttcttggcctcctcagagcactgaaccaatttgcccacagcatatggag
caacttgctagtggacacccaagcatatccccacattttggcaagaccacagtaatttct
gagaatgcctacccctctggccctggagtacagcatcctatgctaattcctgatcctctg
ggctatggtaatatcactgtgagggagtcctatactacctctggcactctgaaaccctct
gtccactttcatgataaccagcaagcttcaaatgtggtggtgacagagagagtggtgggc
cccatctctggtgctgatttgcatggcatgttagagatacctgccttaagagatggaaca
aatgttatagtgacagaaagggtaatagcaccaggctcaagtttacccaattctctaacc
attcctaaccctcgagagacctcaaatgtagttgtgacagaaagagtgatccaaccaacc
tctggcatgataggcaacctgagcatccccccctga

KEGG   Mus musculus (mouse): 225256
Entry
225256            CDS       T01002                                 

Gene name
Dsg1b, Dsg, Dsg5, dsg1-beta
Definition
(RefSeq) desmoglein 1 beta
  KO
K07596  desmoglein 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    225256 (Dsg1b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mmu04515]
    225256 (Dsg1b)
Cell adhesion molecules [BR:mmu04515]
 Cadherins
  Major cadherins
   225256 (Dsg1b)
SSDB
Motif
Pfam: Cadherin Cadherin_C Cadherin_3
Other DBs
NCBI-GeneID: 225256
NCBI-ProteinID: NP_859010
MGI: 2664357
Ensembl: ENSMUSG00000061928
Vega: OTTMUSG00000028139
UniProt: Q7TSF1 B2RQH0
Position
18 A2; 18 11.32 cM
AA seq 1060 aa
MDWHSFRIAALLLTSLVVLEVNSEFQIQVRDHNAKNGTIKWHSIRRQKREWIKFAAACRE
GEDNSKRNPIAKIHSDCAANQPVTYRISGVGIDQPPYGIFIINQKTGEINITSIVDREVT
PFFIIYCRALNAQGQDLENPLELRVRVMDINDNPPVFSMTTFLGQIEENSNANTLVMKLN
ATDADEPNNLNSMIAFKIIRQEPSDSPMFIINRKTGEIRTMNNFLDREQYSQYSLVVRGS
DRDGGADGMSAESECSITILDVNDNIPYLEQSSYDIEIEENALHSQLVQIRVIDLDEEFS
DNWKAIIFFISGNEGNWFEIEMNERTNVGTLKVVKPLDYEAMKNLQLSIGVRNVAEFHQS
IISQYRLTATMVTVTVLNVIEGSVFRPGSKTFVVDSRMEANHRVGEFVATDLDTGRASTN
VRYEMGNNPENLLVVDSRTGIITLRNRVTMEQYQRLNGEYKGTVLSIDDSLQRTCTGTIV
IELSGTGWVPGSDGGGSSSGSGGNRDPVTNGYQGTSTVGPQRVTGSGGVTSSGGGSGVNN
TPGRQNPLDEPEPEPFDITEDNVHFGPAGIGLLIMGFLVLGLVPFLLICCDCGGAPGGGA
GFEPVPECSDGAIHTWAIEGPQPEPHDGITTICVPQMPPGNANVIEYIDNSGVYTNEYCG
REMQDLGGGERTTGFELMDGVKTSAAPEICQEYSGTLRRNSMRECRDGGLNMNFMESYFC
QKAYAYADEDEGRPSNDCLLIYDIEGVGSPAGSVGCCSFIGEDLDESFLDTLGPKFKKLA
DISLGKEIDSYPDPDSSWPPQSTEPMCPQSTEPLGSGYPPISPHFGTTTVISENAYPSGP
GVQHPLPIPDPLGYGNVTVRESYATSGTLKPSVHFHDNQQASNVVVTERVVGPVPGADLH
GMLEIPDLRDGTNVIVTERVIAPGSSLPTSLTIPNPRETSNVVVTERVIQPTSGMIGNLS
MTPELSSAQNVIVTERVVSGAGMSGIAGTAGLGGVGGIGSSGLVSTTMGAAGTGLNMGGT
ATIGHMRSSSDHHFSQTIGSASPNMARSRITKYSTVQYSK
NT seq 3183 nt   +upstreamnt  +downstreamnt
atggactggcactccttcaggatagctgccctgctgctcacttccctggtggtgcttgaa
gttaacagtgaatttcaaatccaggtaagagatcataacgccaaaaatggtaccatcaag
tggcactccatcagaaggcagaaaagagaatggatcaagtttgctgcagcctgtcgcgaa
ggtgaagacaactcaaagagaaacccaattgccaaaattcattcagattgtgctgcaaac
caaccagtaacataccgcatctcgggagtgggaattgaccagccaccttatggaatcttc
attattaaccaaaaaactggtgaaatcaatataacatccattgttgatcgtgaagtcacc
ccctttttcattatctactgccgagcactgaatgcacaaggtcaagacttggagaatcca
ctggagcttagagtcagagtgatggatataaacgacaaccctcctgtgttttcaatgact
acatttctaggacaaatagaagaaaattctaatgcaaacacactggtaatgaaactcaat
gctaccgatgccgatgagccaaataacttgaactcaatgatagccttcaagatcataaga
caggagccttctgactcaccaatgttcatcatcaacaggaaaactggagaaatcagaaca
atgaataactttctagacagagagcaatatagccagtattcccttgtggtgagaggctca
gaccgggacggtggagcagacggcatgtctgcagagagcgagtgcagcatcaccatcctg
gatgtcaatgacaacatcccatacttggagcagtcatcttatgacatcgaaattgaagaa
aatgcacttcactcacagctagtgcagatcagagtcattgatttggatgaagaattctca
gacaactggaaggcaatcattttctttatctctggaaatgagggaaattggtttgaaata
gaaatgaatgaaagaacaaatgtaggaactctgaaggttgtcaagcccctagattatgaa
gccatgaagaatctacagcttagtattggtgttcgaaatgtagctgaattccaccagtca
attatttctcaatacagactcacagcaactatggtcactgtgactgtgttaaatgtcatc
gagggctctgtgttccgtccaggttcaaagacatttgtagtagacagtagaatggaagca
aatcacagagtgggagagtttgtagctacagacctggacacaggtcgagcttccacaaat
gttagatatgaaatgggaaataacccagagaacctgctggttgttgactcaagaacaggc
ataataacgttaagaaacagagttactatggaacaataccaaaggcttaatggggaatat
aaaggaacagtgctatcaatagatgattcccttcagaggacctgcacggggacaatcgtc
attgaacttagtggcactggctgggtaccaggttcagatggtggtggcagttccagtggc
agtggtggtaatcgtgacccagtgactaatggatatcaaggcacttctactgtgggcccg
caacgcgtcacaggatcagggggagtcacttcaagtggtggaggcagtggagttaacaac
actcccggtaggcaaaatcccttagacgaaccggaacccgagccctttgacatcacagaa
gacaacgttcacttcggtcctgcaggcatcgggctgctcatcatggggttcctagtctta
ggattggttccattcctgctgatctgctgtgattgtggaggggcccctggtggtggagct
ggatttgaacctgttccagaatgttctgatggagcaattcacacgtgggccatagaaggg
ccacagcctgaaccccacgatgggataaccaccatctgtgtgccacaaatgccacctggt
aatgccaatgttatagaatatattgacaactcaggagtttacacaaatgaatattgtggc
agagaaatgcaagatctgggaggaggagaaagaaccacaggatttgaactaatggatgga
gttaaaacatcagctgcacctgagatatgccaagaatattcaggaacattaagaagaaat
tcaatgagagaatgtagagatgggggtctcaacatgaatttcatggaaagttacttctgc
cagaaagcctatgcttatgcggatgaagatgaaggacgtccatccaatgactgtttgctc
atctatgacatcgaaggtgtgggttcccctgcaggctccgtgggctgttgcagtttcatt
ggagaagatctagatgagagcttcctggataccttggggcccaagtttaagaagttggca
gatatcagcctgggaaaagaaatagactcatacccagatcctgattcttcttggcctcct
cagagcactgaaccgatgtgtccccagagtacagagcccctgggtagtggatatccacct
atatccccacattttggtacgaccacagtaatttctgagaatgcctacccttctggccct
ggagtacagcatcctttgccaattcctgatcctctgggctatggcaatgtcactgtaagg
gagtcctatgccacctctggcactctgaagccctctgtccactttcatgataaccagcag
gcttcaaatgtggtggtgacagagagggtggtgggccccgtccctggtgctgatttgcat
ggcatgttagagatacctgacttaagagatggaacaaatgttatagtgacagaaagggta
atagcaccaggctcaagtctacccacttctctgaccattcctaaccctcgagagacctca
aatgtagttgtgacagaaagagtgatccaaccaacctctggcatgataggcaatctgagc
atgacccctgagttatcaagtgcccaaaacgtgattgtgacagagagagtggtttctggt
gctggtatgagtggaattgctggcactgccgggttaggtggggttggaggcataggcagc
agtggccttgttagcaccaccatgggtgctgctggcactgggctgaatatgggaggaaca
gccactattggccacatgaggagttcctctgaccatcactttagtcagacaattggatct
gcctcccccaacatggctcgaagtcgaatcacaaagtacagtacggtacagtatagcaag
tag

DBGET integrated database retrieval system