KEGG   Mus musculus (mouse): 13516
Entry
13516             CDS       T01002                                 

Gene name
Epyc, Dsp, Dspg3, PG-, PG-Lb, SL, SLRR3B, epip
Definition
(RefSeq) epiphycan
  KO
K08127  dermatan sulfate proteoglycan 3 (PG-Lb)
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:mmu00535]
    13516 (Epyc)
Proteoglycans [BR:mmu00535]
 Extracellular matrix (ECM) proteoglycans
  Small leucine-rich proteoglycan (SLRP) family
   class III
    13516 (Epyc)
SSDB
Motif
Pfam: LRR_8 LRR_4 LRR_5 LRRNT LRR_9
Other DBs
NCBI-GeneID: 13516
NCBI-ProteinID: NP_031910
MGI: 107942
Ensembl: ENSMUSG00000019936
Vega: OTTMUSG00000024039
UniProt: P70186
Position
10 C3; 10 50.35 cM
AA seq 322 aa
MGMLARVALGLIIIDAVLAAPTTELFNYDSEVYDAILEDTGTFYNYEHIPDNHVENEKVS
ERLSGNRELLTPGPQLGDNQDEDKDEESTPRLIDGSSPQEPEFPGLLGPHTNEDFPTCLL
CTCISTTVYCDDHELDAIPPLPKKTTYFYSRFNRIKKINKNDFASLNDLKRIDLTSNLIS
EIDEDAFRKLPHLQELVLRDNKIKQLPELPNTLTFIDISNNRLGRKGIKQEAFKDMYDLH
HLYITDNSLDHIPLPLPESLRALHLQNNDILEMHEDTFCNVKNLTYVRKALEDIRLDGNP
INLSRTPQAYMCLPRLPIGSFI
NT seq 969 nt   +upstreamnt  +downstreamnt
atgggaatgctagcaagagttgccctgggacttatcatcattgatgctgtattggctgca
ccaactacagagctctttaactatgactcagaagtgtatgatgccatcttggaggacaca
gggaccttttataactatgaacacattcctgacaaccatgtagagaacgagaaagtgtct
gagaggctttctgggaacagagagctcctgaccccaggcccacagctaggggacaaccag
gatgaagacaaggatgaagaatctactcccaggctgatcgatggctcttccccacaggag
ccagaattcccggggcttctgggtccacacaccaacgaagactttccaacttgtctcctg
tgtacttgtataagtaccactgtatactgtgatgaccatgaactggacgctattcctcca
ctgcccaagaagactacatatttctattcacgttttaacagaattaaaaagatcaacaaa
aatgactttgcaagcttaaatgatttaaaaaggatcgatctgacatcaaatttaatatcg
gagattgatgaagatgcattccgaaagctgcctcacctccaagagctggttctgcgtgac
aataagataaagcagcttccagaattgccaaacactttgacatttattgatatcagcaac
aatagactgggaagaaaaggcattaaacaagaagcttttaaagatatgtatgatctccac
catctctatatcaccgataacagcttggaccacatccctctaccactcccagaaagtctg
cgggctcttcacctccagaataatgacattctggagatgcatgaagatactttctgcaat
gttaaaaatttaacttatgttcgtaaggcattagaggatattcgactggatggaaaccct
atcaacctcagcagaactcctcaagcctacatgtgtctacctcgtttgcccattgggagt
tttatctaa

DBGET integrated database retrieval system