KEGG   Mus musculus (mouse): 13522Help
Entry
13522             CDS       T01002                                 

Gene name
Adam28, C130072N01Rik, D430033C21Rik, Dtgn1, MDC-L, MDCL, TECADAM, eMDCII
Definition
(RefSeq) a disintegrin and metallopeptidase domain 28
  KO
K08614  disintegrin and metalloproteinase domain-containing protein 28 [EC:3.4.24.-]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:mmu01002]
    13522 (Adam28)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     13522 (Adam28)
Peptidases [BR:mmu01002]
 Metallo Peptidases
  Family M12: astacin/adamalysin family
   13522 (Adam28)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Reprolysin Pep_M12B_propep ADAM_CR Disintegrin Reprolysin_3 Reprolysin_5 Reprolysin_2 Reprolysin_4 Peptidase_M57 FAM176
Motif
Other DBs
NCBI-GeneID: 13522
NCBI-ProteinID: NP_034212
MGI: 105988
Ensembl: ENSMUSG00000014725
UniProt: Q9JLN6
Position
14; 14 D1
AA seq 793 aa AA seqDB search
MQQWSLLVVSFLLSPVPVSAIKELPKAKKYEVVYPIRLHPLRKRETQEPEPKETFETELR
YKMTVNGKVAVLYLKKNNKLLAPDYSETYYNSSGNKVTTSPQIMDSCYYQGHIVNEKVSA
ASISTCQGLRGYISQGDEKYFIEPLSSENLDEQAHALFKDDSNEDQEKSNCGVDDALWLQ
GLHQDVALPATRLIKLNDGMVQEPKKYIEYYVVLDNGEFKKYNKNLAEIRKIVLEMANYI
NMLYNKLDAHVALVGVEIWTDGDKIKITPDANTTLENFSKWRGNDLLKRKHHDIAQLISS
TDFSGSTVGLAFMSSMCSPYHSVGIVQDHSNYHLRVAGTMAHEMGHNLGMIHDYLSCKCP
SEVCVMEQSLRFHMPTDFSSCSRVNYKQFLEEKLSHCLFNSPLPSDIISTPVCGNQLLEM
NEDCDCGTPKECTNKCCDARTCKIKAGFQCALGECCEKCQLKKPGVVCRAAKDECDLPEV
CDGKSSHCPGDRFRVNGSPCQNGHGYCLKGKCPTLQQQCMDMWGPGTKVANTSCYKQNEG
GTKYGYCHVENGTHMPCKAKDAMCGKLFCEGGSGDLPWKGLTISFLTCKLFDPEDTSQGV
DMVANGTKCGTNKVCINAECVDMEKTYKSANCSSKCKGHAVCDHELQCQCKEGWAPPDCE
NSATVFHFSIVVGVLFPLAVIFVVVAIVIQRQSARRKQRRVQRLPSTKDAKLHNQKCRPQ
KVKDVQPQEMSQMKKLHVSDLPSEEPEPPPDVLITKPNFPPPPIPVSLTGRAKVPFVKTP
HPFSQQIGRVYLK
NT seq 2382 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaatggagtcttctggtagtctctttccttctttctccagttccagtaagtgca
ataaaagaactccctaaagccaagaaatatgaagtggtttatcccataagacttcatcca
ttgcgtaaaagagagacccaagagccagagccaaaggaaacatttgaaactgagctaagg
tacaaaatgacagtaaatggaaaggttgctgtgctgtatctgaagaagaacaacaagctc
cttgcgcctgactactcggaaacatactataattccagtggaaacaaggtcaccacaagc
ccgcaaatcatggatagctgttactaccaaggacacatcgtaaatgagaaagtttctgca
gccagcatcagcacctgtcaaggactacggggttacatcagtcaaggagatgaaaagtat
tttatcgaacctttgagctcggagaacttggatgaacaggcacatgcactcttcaaggac
gactccaatgaagaccaggagaagagcaactgtggtgtggatgatgcgctatggctccaa
gggctgcatcaggacgtggccctccctgccaccaggttgattaagttgaatgatgggatg
gttcaagaacctaagaaatacatagaatattatgtggtcctggataatggtgagtttaag
aaatacaataaaaatcttgctgaaatacgaaagatagtgcttgagatggccaattacatc
aacatgctttacaataagcttgatgcccacgtggccttagttggagtggaaatctggacc
gatggggataaaataaagataacaccagatgccaacaccaccctggaaaacttctctaag
tggaggggaaatgatctgctaaaacgaaagcatcatgatattgcccagctaatctcatca
acagacttttctggatcaacagtgggtctagccttcatgtcgtcgatgtgttcaccttac
cattctgttggcattgttcaggaccacagtaactaccatcttcgagtcgcaggaacaatg
gctcatgaaatgggtcacaatcttggcatgattcatgactacttgagctgcaagtgtcca
tctgaagtctgtgtaatggagcagtcactaaggttccatatgcctacagacttcagctcc
tgcagtcgtgtcaattacaaacagtttcttgaagaaaaattatcgcattgcctctttaat
agcccattgccatcagatatcatatccaccccagtctgtgggaaccagttgttggaaatg
aatgaggactgtgactgtggcacacccaaggagtgtactaacaaatgctgtgatgcaagg
acctgtaaaattaaagcaggtttccagtgtgccctgggggaatgctgtgagaaatgccaa
cttaaaaaacctggggttgtgtgcagagcagcaaaagatgagtgtgatctgcctgaagtg
tgtgatggtaaatccagccactgcccaggtgacagattcagagtcaatggctccccttgc
caaaatgggcatggttactgcttgaagggcaaatgtcccaccctgcagcagcagtgcatg
gacatgtggggtccaggaaccaaggttgcaaatacatcatgttacaagcagaatgaaggt
gggacaaagtacggatactgtcatgtggagaatggcacacacatgccctgcaaagcaaaa
gatgccatgtgtgggaaattgttctgtgaaggcggatcaggtgatttgccctggaaagga
cttaccatatctttcctgacatgtaaattatttgatcctgaagacacaagtcaaggagta
gacatggtggccaatggaaccaagtgtggaactaacaaggtgtgcattaatgctgagtgt
gtggacatggagaagacttacaagtcagccaactgctcctcaaagtgcaaggggcacgca
gtgtgtgaccatgagcttcagtgtcagtgcaaggaaggatgggcccctcctgactgcgag
aattcagccacagtcttccacttctccatcgtggttggcgtgcttttccccctagcagtc
atatttgtggtggttgctatagtgatccagcgccaaagtgccagaaggaagcagaggaga
gttcagaggctaccatccaccaaggatgccaagctacacaatcagaagtgtagaccccaa
aaggtgaaggatgttcaaccccaggagatgagtcagatgaaaaagctccatgtgtctgat
ctgccctctgaagagccggagcctccacctgatgtcctaatcacaaagccaaatttccca
ccaccaccaattcctgtttccttgacaggaagagccaaagttccttttgtcaagacacct
catccttttagtcagcaaataggccgcgtgtacctgaagtaa

DBGET integrated database retrieval system