KEGG   Mus musculus (mouse): 13527Help
Entry
13527             CDS       T01002                                 

Gene name
Dtna, 2210407P21Rik, DTN-A, Dtn, Gm19389, a-DB-1, adbn
Definition
(RefSeq) dystrobrevin alpha
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_2 EF-hand_3 ZZ C1_2 CRISPR_Cse2 SOGA Seryl_tRNA_N
Motif
Other DBs
NCBI-GeneID: 13527
NCBI-ProteinID: NP_001272736
MGI: 106039
Ensembl: ENSMUSG00000024302
UniProt: Q9D2N4 A0A1Y7VL34
Position
18 A2; 18 12.08 cM
AA seq 746 aa AA seqDB search
MIEDSGKRGNTMAERRQLFAEMRAQDLDRIRLSTYRTACKLRFVQKKCNLHLVDIWNVIE
ALRENALNNLDPNIELNVARLEAVLSTIFYQLNKRMPTTHQIHVEQSISLLLNFLLAAFD
PEGHGKISVFAVKMALATLCGGKIMDKLRYIFSMISDSSGVMVYGRYDQFLREVLKLPTA
VFEGPSFGYTEQSARSCFSQQKKVTLNGFLDTLMSDPPPQCLVWLPLLHRLANVENVFHP
VECSYCHSESMMGFRYRCQQCHNYQLCQDCFWRGHAGGSHSNQHQMKEYTSWKSPAKKLT
NALSKSLSCASSREPLHPMFPDQPEKPLNLAHIVPPRPVTSMNDTLFSHSVPSSGSPFIT
RSSPPKDSEVEQNKMLARAAPAFLKGRGIQYSLNVADRLADEHVLIGLYVNMLRNNPPCM
LESSNRLDEEHRLIARYAARLAAESSSSQPTQQRSAPDISFTIDANKQQRQLIAELENKN
REILQEIQRLRVEHEQASQPTPEKAQQNPTLLAELRLLRQRKDELEQRMSALQESRRELM
VQLEGLMKLLKEEELKQGTQGASSPRSSPSHTISRPIPMPIRSASACPTPTHTPQDSLTG
VGGDVQEAFAQSSRRNLRSDLLVAADSITNTMSSLVKELNSEVASETESTVDSEFSRPQF
EDLAPSPTSEKAFLAQIHSRKPGYIHGGAASTTHGDMVPEDGDPYTQPEDGNYENESVRQ
LENELQLEEYLKQKLQDEAYQVSLQG
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
atgattgaagatagtggaaaaagaggaaacaccatggcagaaagaagacagctgtttgca
gagatgagggctcaagatctggatcgcatccgactctccacctacagaacagcatgcaag
ctgagatttgtgcagaagaaatgcaatttgcacctggtggacatttggaacgtcattgaa
gcattgcgcgaaaacgctttgaataacctggacccaaacatagaactcaacgtggcccgc
ctggaggcggtgctctccactattttttaccagctcaacaagaggatgccaaccactcac
caaatccacgtggagcagtccatcagtctcctgctgaacttcctgctcgcagcctttgac
ccggaaggccatggaaaaatctcagtatttgctgtcaaaatggctttggctacattgtgt
ggaggaaagatcatggacaagttaagatatattttctcaatgatctctgactccagtgga
gtgatggtatatggaagatatgaccaattccttcgggaagttctcaaactacccacagca
gtttttgaaggtccttcatttggttacacagaacagtcagccagatcctgtttctcccaa
cagaaaaaggtcaccttaaatggcttcttggacacgctcatgtcagaccctcctccacag
tgcctggtatggctgcctcttctgcaccgactggcaaatgtagaaaatgtcttccatcca
gttgagtgttcctactgtcacagtgagagcatgatgggatttcgataccgatgtcaacag
tgtcacaactaccagctttgccaggactgcttctggaggggccatgcaggaggttctcat
agcaaccagcaccaaatgaaggagtatacgtcgtggaaatcacctgctaagaagctaacg
aatgcattaagcaagtccctgagctgtgcttcaagccgtgaacctttgcaccccatgttc
ccagaccagcctgaaaagccactcaacttggctcacatcgtgcctccgagacctgtaacc
agcatgaacgacacactcttttcccactctgttccctcctcaggaagtcctttcatcacc
aggagctctcctcccaaggacagtgaagtagaacagaacaaaatgctggctagggctgct
cccgcctttctgaagggcagagggatacagtacagcctgaatgtggcagacaggctagct
gatgaacatgttctcattgggttgtatgtcaacatgctccggaacaacccaccatgtatg
cttgagagttcaaaccggcttgatgaagaacacaggctgatcgccaggtacgccgcacga
ctggcagcagaatcctcctcatcacagcccacacagcagaggagtgcccctgacatctcc
ttcaccatcgatgcaaataaacagcaaaggcagctgattgcagagctagagaacaagaac
agagaaatcttacaagagattcagagacttcgggtagaacatgagcaagcttcccagccc
acgccagagaaagctcagcagaacccaaccttgctggcagaactccggctcctcagacag
cgaaaggatgagctagaacagagaatgtctgctctccaggagagccggagagagctgatg
gtccagttggaaggtctcatgaagctcctgaaggaagaagaactgaagcagggaacccag
ggggcaagctccccacgctcttcccccagccacaccatcagcaggccgatccccatgccc
atccgttcagcatctgcctgtcccacaccaacgcacaccccgcaggactccctcactggg
gtaggcggagatgtgcaagaggcgtttgcacaaagttcgagaaggaatctaaggagtgac
ctgctggtggctgcagactccatcaccaataccatgtcctctctggtgaaggagctgaat
tcagaggtggcgagtgaaacagaaagtactgtggattccgagttctcgagacctcagttt
gaggatctggctccatcaccgacctctgagaaggcttttctagcccaaatccactcccgg
aaacctgggtacattcacggtggagctgcaagtaccacgcatggtgacatggtcccggaa
gatggggatccttacacgcaacccgaggatggcaattatgagaacgagtctgtgcggcag
ctggagaatgagctgcagctggaggagtacctgaagcagaagctgcaggacgaggcctac
caggtcagcttgcaaggttga

DBGET integrated database retrieval system