KEGG   Mus musculus (house mouse): 13542
Entry
13542             CDS       T01002                                 
Symbol
Dvl1, Dvl, mKIAA4029
Name
(RefSeq) dishevelled segment polarity protein 1
  KO
K02353  segment polarity protein dishevelled
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04150  mTOR signaling pathway
mmu04310  Wnt signaling pathway
mmu04330  Notch signaling pathway
mmu04390  Hippo signaling pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu04916  Melanogenesis
mmu04934  Cushing syndrome
mmu05010  Alzheimer disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05217  Basal cell carcinoma
mmu05224  Breast cancer
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    13542 (Dvl1)
   04330 Notch signaling pathway
    13542 (Dvl1)
   04390 Hippo signaling pathway
    13542 (Dvl1)
   04150 mTOR signaling pathway
    13542 (Dvl1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    13542 (Dvl1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    13542 (Dvl1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    13542 (Dvl1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    13542 (Dvl1)
   05226 Gastric cancer
    13542 (Dvl1)
   05217 Basal cell carcinoma
    13542 (Dvl1)
   05224 Breast cancer
    13542 (Dvl1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    13542 (Dvl1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    13542 (Dvl1)
   05022 Pathways of neurodegeneration - multiple diseases
    13542 (Dvl1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    13542 (Dvl1)
SSDB
Motif
Pfam: Dishevelled Dsh_C DIX PDZ DEP PDZ_6 PDZ_2 Shufflon_N
Other DBs
NCBI-GeneID: 13542
NCBI-ProteinID: NP_034221
MGI: 94941
Ensembl: ENSMUSG00000029071
UniProt: P51141
Structure
Position
4:155931829..155943760
AA seq 695 aa
MAETKIIYHMDEEETPYLVKLPVAPERVTLADFKNVLSNRPVHAYKFFFKSMDQDFGVVK
EEIFDDNAKLPCFNGRVVSWLVLAEGAHSDAGSQGTDSHTDLPPPLERTGGIGDSRPPSF
HPNVASSRDGMDNETGTESMVSHRRERARRRNRDEAARTNGHPRGDRRRDLGLPPDSAST
VLSSELESSSFIDSDEEDNTSRLSSSTEQSTSSRLVRKHKCRRRKQRLRQTDRASSFSSI
TDSTMSLNIITVTLNMERHHFLGISIVGQSNDRGDGGIYIGSIMKGGAVAADGRIEPGDM
LLQVNDVNFENMSNDDAVRVLREIVSQTGPISLTVAKCWDPTPRSYFTIPRADPVRPIDP
AAWLSHTAALTGALPRYGTSPCSSAITRTSSSSLTSSVPGAPQLEEAPLTVKSDMSAIVR
VMQLPDSGLEIRDRMWLKITIANAVIGADVVDWLYTHVEGFKERREARKYASSMLKHGFL
RHTVNKITFSEQCYYVFGDLCSNLASLNLNSGSSGASDQDTLAPLPHPSVPWPLGQGYPY
QYPGPPPCFPPAYQDPGFSCGSGSAGSQQSEGSKSSGSTRSSHRTPGREERRATGAGGSG
SESDHTVPSGSGSTGWWERPVSQLSRGSSPRSQASAVAPGLPPLHPLTKAYAVVGGPPGG
PPVRELAAVPPELTGSRQSFQKAMGNPCEFFVDIM
NT seq 2088 nt   +upstreamnt  +downstreamnt
atggcggagaccaaaatcatctaccacatggacgaggaggagacgccgtacctggtcaag
ctgcccgtagctcccgagcgcgtcacgctggccgacttcaagaacgtgctcagcaaccgg
ccggtgcacgcctacaaattcttcttcaagtccatggaccaggacttcggggtggtgaag
gaggagatcttcgatgacaatgccaagttgccctgcttcaatggccgggtggtttcctgg
ctggtcctggctgagggcgctcactcggatgcagggtcccagggcactgacagccacacg
gacctgcccccaccccttgagaggacaggcggcattggggactccaggcccccctccttc
catccaaatgttgccagtagccgggacggaatggacaatgagacaggcacagagtctatg
gtcagtcaccggcgggagcgagcccgacgtcgaaaccgcgatgaggctgcccggaccaat
gggcacccgagaggggatcggcggcgggacctgggactacctccagacagtgcatccact
gtactgagcagtgagcttgaatctagcagctttattgactcagatgaggaggacaatacg
agccggctgagcagctccacagagcagagcacctcctctcggctagttcggaagcacaaa
tgccgtcgtcggaagcagcgcttgaggcagacagaccgggcatcctccttcagcagcatc
acagactccaccatgtccctgaacatcatcaccgtcactctcaacatggagaggcaccac
ttcctgggcatcagcatcgtgggccagagcaacgaccggggtgatggcggcatctacatt
ggatccatcatgaagggcggggccgtggctgctgatggccgcattgagccgggcgacatg
ttgctgcaggtgaacgatgtcaactttgagaacatgagcaatgacgacgctgtacgggtg
cttcgggagatcgtgtcccagacagggcccatcagtctcacagtggccaagtgctgggac
ccaacccctcggagctacttcaccatcccaagggctgacccagtgcgacccatcgacccg
gctgcctggctgtcccacacagcagcactgacgggtgccctgccccgctatggtacgagt
ccctgctccagcgccatcacacgcaccagctcttcctcactaaccagctcagtgcctggc
gccccacagcttgaggaggcaccgctgactgtgaagagtgacatgagtgccattgtccgc
gtcatgcagttgccagactcaggactggagatccgggaccgcatgtggcttaagatcacc
attgccaatgctgtcattggggcggatgtggtggactggctgtacacacacgtggagggc
ttcaaggagcgaagggaggcaagaaagtatgccagcagtatgctgaagcacggtttcctg
aggcacaccgtgaacaagatcaccttttctgagcagtgctactatgtctttggcgacctg
tgcagtaacctcgcatccctgaacctcaacagtggctccagtggagcctcagatcaggac
acactggccccactgccccacccatcagtaccctggcccttgggtcaaggctacccctac
cagtacccaggacccccgccctgcttcccgcctgcttaccaggaccctggcttcagctgc
ggcagcggcagtgctgggagccagcagagtgaagggagcaagagcagtgggtccacacgg
agcagccatcggaccccaggccgagaggagcgccgggcaactggagctgggggtagtggc
agtgaatcagaccacacagtaccaagtgggtctggtagcaccggctggtgggagcggcct
gtcagccagcttagccgtggcagtagccctcgaagtcaggcttcagctgttgccccaggg
ctccccccactgcacccccttacaaaggcctatgcagtagtgggtgggccacctggaggg
ccacccgtccgggagctggctgctgtccctccagaacttacaggtagccgccagtccttc
caaaaggccatgggaaacccctgtgagttctttgtggacatcatgtga

DBGET integrated database retrieval system