KEGG   Mus musculus (mouse): 13544Help
Entry
13544             CDS       T01002                                 

Gene name
Dvl3, b2b2866Clo
Definition
(RefSeq) dishevelled segment polarity protein 3
  KO
K02353  segment polarity protein dishevelled
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04150  mTOR signaling pathway
mmu04310  Wnt signaling pathway
mmu04330  Notch signaling pathway
mmu04390  Hippo signaling pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu04916  Melanogenesis
mmu04934  Cushing syndrome
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05217  Basal cell carcinoma
mmu05224  Breast cancer
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    13544 (Dvl3)
   04330 Notch signaling pathway
    13544 (Dvl3)
   04390 Hippo signaling pathway
    13544 (Dvl3)
   04150 mTOR signaling pathway
    13544 (Dvl3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    13544 (Dvl3)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    13544 (Dvl3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    13544 (Dvl3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    13544 (Dvl3)
   05226 Gastric cancer
    13544 (Dvl3)
   05217 Basal cell carcinoma
    13544 (Dvl3)
   05224 Breast cancer
    13544 (Dvl3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    13544 (Dvl3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    13544 (Dvl3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Dsh_C Dishevelled DIX PDZ DEP PDZ_6 Shufflon_N
Motif
Other DBs
NCBI-GeneID: 13544
NCBI-ProteinID: NP_031915
MGI: 108100
Ensembl: ENSMUSG00000003233
Vega: OTTMUSG00000035778
UniProt: Q61062
Position
16 A3; 16 12.46 cM
AA seq 716 aa AA seqDB search
MGETKIIYHLDGQETPYLVKLPLPAERVTLADFKGVLQRPSYKFFFKSMDDDFGVVKEEI
SDDNAKLPCFNGRVVSWLVSAEGSHPEPAPFCADNPSELPPSMERTGGIGDSRPPSFHPH
ASGGSQENLDNDTETDSLVSAQRERPRRRDGPEHAARLNGTTKGERRREPGGYDSSSTLM
SSELETTSFFDSDEDDSTSRFSSSTEQSSASRLMRRHKRRRRKQKVSRIERSSSFSSITD
STMSLNIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIMKGGAVAADGRIEPGDMLL
QVNEINFENMSNDDAVRVLREIVHKPGPITLTVAKCWDPSPRGCFTLPRSEPIRPIDPAA
WVSHTAAMTGTFPAYGMSPSLSTITSTSSSITSSIPDTERLDDFHLSIHSDMAAIVKAMA
SPESGLEVRDRMWLKITIPNAFIGSDVVDWLYHNVEGFTDRREARKYASNLLKAGFIRHT
VNKITFSEQCYYIFGDLCGNMANLSLHDHDGSSGASDQDTLAPLPHPGAAPWPMAFPYQY
PPPPHPYNPHPGFPELGYSYGGGSASSQHSEGSRSSGSNRSGSDRRKEKDPKAGDSKSGG
SGSESDHTTRSSLRGPRERAPSERSGPAASEHSHRSHHSLTSSLRSHHTHPSYGPPGVPP
LYGPPMLMMTPPPAAMGPPGAPPGRDLASVPPELTASRQSFRMAMGNPSEFFVDVM
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atgggcgagaccaagatcatctaccacctggacggccaggagacgccgtacctggtgaag
ctgcccctgcccgccgagcgcgtcaccttggcggactttaagggcgttctgcagcggccc
agctataagttcttcttcaagtctatggacgacgattttggggtggtgaaggaagagatc
tcggacgacaatgccaagctaccctgcttcaatggccgggtggtgtcctggctggtatct
gccgagggctcacacccagagccggcccctttctgtgctgacaacccgtcagagctgcca
ccttcgatggaacgcacaggaggcattggggactctcgacccccctccttccaccctcat
gctagtgggggcagccaggagaatctggacaatgacacggagaccgactccttggtgtct
gcccaacgagagcggccccgacggagggatggcccggagcacgcagcccgactcaatgga
accacaaagggtgagcggcgacgggagccaggcggctatgacagttcatctaccctcatg
agcagcgagctggagactaccagtttctttgattccgatgaggatgattccaccagcagg
ttcagcagctccacagaacagagcagtgcctcacgcctcatgagaagacacaagcggcgg
cggcggaagcagaaggtctcccggattgagcggtcctcgtctttcagcagcatcacagac
tccactatgtctctcaacatcatcaccgtcactctcaacatggaaaagtataacttcttg
ggcatctccattgtgggccaaagcaatgagcgaggtgatgggggcatctacattggctcc
atcatgaagggtggggctgtggcagctgatggacgcattgagccaggagatatgctactg
caggtaaatgagatcaacttcgagaacatgagcaacgatgacgcagtccgagtccttcgg
gagattgtgcacaagccagggcccatcactctgactgtagccaagtgctgggacccaagt
cctcgcggctgcttcacattaccccggagcgagcccatccgtcccattgaccctgcagcc
tgggtctctcacacggcagccatgacaggcaccttccccgcctatggcatgagcccctcc
ttaagcaccatcacctctaccagctcctccatcaccagctccatccctgatacagagcgc
ctagatgatttccacctctccatccacagtgacatggcggccatcgtaaaagccatggcc
tcccctgagtcagggttggaggtccgagaccgcatgtggctcaagattaccattcccaat
gctttcatcggctcggatgtggtggactggctgtaccacaacgtggaagggttcaccgac
cgtcgggaggcccgcaagtatgctagcaacctgctgaaagctggtttcatccgccatacc
gtcaacaagatcacgttctccgagcagtgctactacatctttggcgacctctgtggtaac
atggccaacctatcgcttcacgaccatgatggctccagtggcgcctctgaccaggacaca
ctggctcctttgccgcacccaggagctgccccttggcctatggctttcccttaccagtac
ccaccacctccgcatccctacaacccacacccaggcttcccagaactgggctacagctac
ggtgggggcagcgccagcagtcagcacagtgaaggcagtcggagcagtggctccaaccga
agtggcagcgaccggcgcaaggagaaggacccaaaagctggggactccaagtcaggtggt
agcggcagcgagtcagaccacactacacgcagcagtctgagggggccacgggagcgggca
ccaagcgagcgatcaggcccagcggccagcgagcacagccaccgcagtcaccattcgctg
accagcagcctgcgcagccaccacacacacccaagctatggcccacccggagtgccccct
ctctatggtcccccgatgctgatgatgaccccgccgccggcagccatgggtcccccagga
gcccctccagggcgtgacctggcctcggtgcccccggaactgacggccagcagacagtcc
ttccgcatggcaatgggaaaccccagtgagttctttgtggatgtgatgtga

DBGET integrated database retrieval system