KEGG   Mus musculus (mouse): 13555Help
Entry
13555             CDS       T01002                                 

Gene name
E2f1, E2F-1, Tg(Wnt1-cre)2Sor, mKIAA4009
Definition
(RefSeq) E2F transcription factor 1
  KO
K17454  transcription factor E2F1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01522  Endocrine resistance
mmu04110  Cell cycle
mmu04137  Mitophagy - animal
mmu04218  Cellular senescence
mmu04934  Cushing syndrome
mmu05161  Hepatitis B
mmu05163  Human cytomegalovirus infection
mmu05165  Human papillomavirus infection
mmu05166  HTLV-I infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05200  Pathways in cancer
mmu05206  MicroRNAs in cancer
mmu05212  Pancreatic cancer
mmu05214  Glioma
mmu05215  Prostate cancer
mmu05218  Melanoma
mmu05219  Bladder cancer
mmu05220  Chronic myeloid leukemia
mmu05222  Small cell lung cancer
mmu05223  Non-small cell lung cancer
mmu05224  Breast cancer
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
Module
mmu_M00692  Cell cycle - G1/S transition
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    13555 (E2f1)
  09143 Cell growth and death
   04110 Cell cycle
    13555 (E2f1)
   04218 Cellular senescence
    13555 (E2f1)
 09160 Human Diseases
  09161 Cancers
   05200 Pathways in cancer
    13555 (E2f1)
   05206 MicroRNAs in cancer
    13555 (E2f1)
   05212 Pancreatic cancer
    13555 (E2f1)
   05225 Hepatocellular carcinoma
    13555 (E2f1)
   05226 Gastric cancer
    13555 (E2f1)
   05214 Glioma
    13555 (E2f1)
   05220 Chronic myeloid leukemia
    13555 (E2f1)
   05218 Melanoma
    13555 (E2f1)
   05219 Bladder cancer
    13555 (E2f1)
   05215 Prostate cancer
    13555 (E2f1)
   05224 Breast cancer
    13555 (E2f1)
   05222 Small cell lung cancer
    13555 (E2f1)
   05223 Non-small cell lung cancer
    13555 (E2f1)
  09166 Endocrine and metabolic diseases
   04934 Cushing syndrome
    13555 (E2f1)
  09167 Infectious diseases
   05166 HTLV-I infection
    13555 (E2f1)
   05161 Hepatitis B
    13555 (E2f1)
   05163 Human cytomegalovirus infection
    13555 (E2f1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    13555 (E2f1)
   05165 Human papillomavirus infection
    13555 (E2f1)
  09168 Drug resistance
   01522 Endocrine resistance
    13555 (E2f1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    13555 (E2f1)
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    13555 (E2f1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: E2F_CC-MB E2F_TDP
Motif
Other DBs
NCBI-GeneID: 13555
NCBI-ProteinID: NP_031917
MGI: 101941
Ensembl: ENSMUSG00000027490
Vega: OTTMUSG00000015917
UniProt: Q61501 Q547J6 Q9CYB4
Position
2 H1; 2 76.79 cM
AA seq 430 aa AA seqDB search
MAVAPAGGQHAPALEALLGAGALRLLDSSQIVIISTAPDVGAPQLPAAPPTGPRDSDVLL
FATPQAPRPAPSAPRPALGRPPVKRRLDLETDHQYLAGSSGPFRGRGRHPGKGVKSPGEK
SRYETSLNLTTKRFLELLSRSADGVVDLNWAAEVLKVQKRRIYDITNVLEGIQLIAKKSK
NHIQWLGSHTMVGIGKRLEGLTQDLQQLQESEQQLDHLMHICTTQLQLLSEDSDTQRLAY
VTCQDLRSIADPAEQMVIVIKAPPETQLQAVDSSETFQISLKSKQGPIDVFLCPEESADG
ISPGKTSCQETSSGEDRTADSGPAGPPPSPPSTSPALDPSQSLLGLEQEAVLPRMGHLRV
PMEEDQLSPLVAADSLLEHVKEDFSGLLPGEFISLSPPHEALDYHFGLEEGEGIRDLFDC
DFGDLTPLDF
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atggccgtagcccccgcgggcggccagcacgcgccagcgctggaggccctgctcggggcg
ggcgcgttgcggctgctcgactcctcgcagatcgtcatcatctccaccgcgcccgatgtc
ggcgccccgcagctccccgccgcgccgcccactggccctcgcgattctgacgtgctgctc
ttcgccacgccgcaggcgccccgacccgcgcctagtgcaccgcgcccggctctcggccgc
ccgccggtgaaacggaggctggatctggagactgaccatcagtacctcgctggtagcagt
gggccattccggggcagaggccgccacccagggaaaggtgtgaaatctccgggggagaag
tcacgctatgaaacctcactaaatctgaccaccaaacgcttcttggagctgctgagccgc
tcagctgacggtgtcgttgacctgaactgggcagctgaggtgctgaaggtgcagaaacgg
cgcatctatgacatcaccaatgtcctggagggcatccagctcattgccaagaagtccaag
aatcatatccagtggctaggcagccacaccatggtggggattggtaagcggcttgaaggc
ctgacccaggacctgcagcaactgcaggagagtgagcagcagctggatcacctgatgcac
atctgtaccacacagctgcaactgctttcggaggactccgacacccagcgcctggcctat
gtgacctgccaggaccttcgcagcattgcagaccctgcagaacagatggtcatagtgatc
aaggcccctcctgagacccaactacaagctgtggattcttcagagacatttcagatctcc
cttaagagcaaacaaggccccattgatgttttcctgtgcccggaggagagtgcagacggg
attagccctgggaagacctcatgccaggagacatcctctggggaggaccggactgcagac
tctggcccagcagggcctccaccatcacctccctccacatccccagccttggatcccagt
caatccctgttgggcctggagcaagaagcagtattgccacggatgggccacctgagggtc
cctatggaagaggaccaactgtcaccactggtggctgctgactcactcctggagcatgtt
aaagaagacttctctgggctcctccctggggagttcatcagcctctccccaccccacgag
gcccttgactatcactttggtctcgaggagggtgagggcattagagatctctttgactgt
gactttggggacctgacccctctggatttctga

DBGET integrated database retrieval system