KEGG   Mus musculus (mouse): 13559
Entry
13559             CDS       T01002                                 

Symbol
E2f5, AU024671, E2F-5
Name
(RefSeq) E2F transcription factor 5
  KO
K04682  transcription factor E2F4/5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04110  Cell cycle
mmu04218  Cellular senescence
mmu04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    13559 (E2f5)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    13559 (E2f5)
   04218 Cellular senescence
    13559 (E2f5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    13559 (E2f5)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    13559 (E2f5)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP TMEM171
Other DBs
NCBI-GeneID: 13559
NCBI-ProteinID: NP_031918
MGI: 105091
Ensembl: ENSMUSG00000027552
Vega: OTTMUSG00000051204
UniProt: Q61502
Position
3; 3 A1
AA seq 335 aa
MAAAEPTSSAQPTPQAQAQPPPHGAPSSQPSAALAGGSSRHEKSLGLLTTKFVSLLQEAQ
DGVLDLKAAADTLAVRQKRRIYDITNVLEGIDLIEKKSKNSIQWKGVGAGCNTKEVIDRL
RCLKAEIEDLELKERELDQQKLWLQQSIKNVMEDSINNRFSYVTHEDICNCFHGDTLLAI
QAPSGTQLEVPIPEMGQNGQKKYQINLKSHSGPIHVLLINKESSSSKPVVFPVPPPDDLT
QPSSQSSTSVTPQKSTMAAQNLPEQHVSERSQTFQQTPAAEVSSGSISGDIIDELMSSDV
FPLLRLSPTPADDYNFNLDDNEGVCDLFDVQILNY
NT seq 1008 nt   +upstreamnt  +downstreamnt
atggcggcggcggagcccacgagctctgctcagcccacgccgcaggcccaggctcagccg
ccgccgcatggggcgccatcctcgcagccgtccgcggcgctcgcggggggcagcagccgg
cacgagaagagcctgggcttgcttaccaccaaattcgtgtcgttgctgcaggaggcgcag
gacggcgtcctggatctcaaagcggctgcagataccttggctgtgaggcaaaagcgaaga
atttatgatatcaccaatgtcttagagggaattgatctaattgaaaaaaaatcaaagaac
agtatccagtggaagggtgtaggtgctggctgtaatactaaagaagttatcgatagatta
aggtgtcttaaagctgaaattgaagatctcgaattgaaggaaagagaacttgaccagcag
aagttgtggctacagcaaagcatcaaaaatgtgatggaagactccattaataacagattt
tcttatgtaactcacgaagacatctgcaattgctttcatggtgatacactgttggccatt
caggcaccttctggtacacagctggaagtacctattccagaaatgggacagaatggacaa
aagaaataccagataaatctgaagagtcactcagggcctatccatgtgctacttataaat
aaagagtccagttcatctaagccagtggtttttcctgttcccccacctgatgacctcaca
cagccttcctcccagtcctcaacttcagtgactccacagaaatccaccatggctgctcaa
aacctgcctgagcagcatgtttccgaaagaagccagactttccagcagacaccagctgca
gaagtatcttcaggatctattagtggagacatcattgatgaactgatgtcttctgatgtg
tttcctcttttacggctttctcctaccccagcagatgactacaactttaatttagatgat
aatgaaggagtttgtgatctgtttgatgttcagatactaaattattag

DBGET integrated database retrieval system