KEGG   Mus musculus (mouse): 13590
Entry
13590             CDS       T01002                                 

Gene name
Lefty1, AI450052, Ebaf, Leftb, Stra3, Tgfb4, lefty, lefty-1
Definition
(RefSeq) left right determination factor 1
  KO
K04668  left-right determination factor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04350  TGF-beta signaling pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    13590 (Lefty1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    13590 (Lefty1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    13590 (Lefty1)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   13590 (Lefty1)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 13590
NCBI-ProteinID: NP_034224
MGI: 107405
Ensembl: ENSMUSG00000038793
Vega: OTTMUSG00000021473
UniProt: Q64280
Position
1; 1 H4
AA seq 368 aa
MPFLWLCWALWALSLVSLREALTGEQILGSLLQQLQLDQPPVLDKADVEGMVIPSHVRTQ
YVALLQHSHASRSRGKRFSQNLREVAGRFLVSETSTHLLVFGMEQRLPPNSELVQAVLRL
FQEPVPRTALRRQKRLSPHSARARVTIEWLRFRDDGSNRTALIDSRLVSIHESGWKAFDV
TEAVNFWQQLSRPRQPLLLQVSVQREHLGPGTWSSHKLVRFAAQGTPDGKGQGEPQLELH
TLDLKDYGAQGNCDPEAPVTEGTRCCRQEMYLDLQGMKWAENWILEPPGFLTYECVGSCL
QLPESLTSRWPFLGPRQCVASEMTSLPMIVSVKEGGRTRPQVVSLPNMRVQTCSCASDGA
LIPRRLQP
NT seq 1107 nt   +upstreamnt  +downstreamnt
atgccattcctgtggctctgctgggcactctgggcactgtcgctggttagcctcagggaa
gccctgaccggagagcagatcctgggcagcctgctgcaacagctgcagctcgatcaaccg
ccagtcctggacaaggctgatgtggaagggatggtcatcccctcgcacgtgaggactcag
tatgtggccctgctacaacacagccatgccagccgctcccgaggcaagaggttcagccag
aaccttcgagaggtggcaggcaggttcctggtgtcagagacctccactcacctgctagtg
ttcggaatggagcagcggctgccgcctaacagcgagctggtgcaggctgtgctgcggctg
ttccaggagcctgtgcccagaacagctctccggaggcaaaagaggctgtccccacacagt
gcccgggctcgggtcaccattgaatggctgcgcttccgcgacgacggctccaaccgcact
gcccttatcgattctaggctcgtgtccatccacgagagcggctggaaggccttcgacgtg
accgaggccgtgaacttctggcagcagctgagccggccgaggcagccgctgctgctccag
gtgtcggtgcagagggagcatctggggccgggaacctggagctcacacaagttggttcgt
ttcgcggcgcaggggacgccggatggcaaggggcagggcgagccacagctggagctgcac
acgctggacctcaaggactatggagctcaaggcaattgtgaccccgaggcaccagtgact
gaaggcacccgatgctgtcgccaggagatgtacctggacctgcaggggatgaagtgggcc
gagaactggatcctagaaccgccagggttcctgacatatgaatgtgtgggcagctgcctg
cagctaccggagtccctgaccagcaggtggccatttctggggcctcggcagtgtgtcgcc
tcagagatgacctccctgcccatgattgtcagcgtgaaggagggaggcaggaccaggcct
caagtggtcagcctgcccaacatgagggtgcagacctgtagctgcgcctcagatggggcg
ctcatacccaggaggctgcagccatag

DBGET integrated database retrieval system