KEGG   Mus musculus (mouse): 13602
Entry
13602             CDS       T01002                                 

Symbol
Sparcl1, Ecm2, Sc, Sc1, he, hevin, mas, mast9
Name
(RefSeq) SPARC-like 1
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: SPARC_Ca_bdg Kazal_1 Kazal_2 FOLN EF-hand_1 Basic EF-hand_6
Other DBs
NCBI-GeneID: 13602
NCBI-ProteinID: NP_034227
MGI: 108110
Ensembl: ENSMUSG00000029309
Vega: OTTMUSG00000053770
UniProt: P70663 Q3TYD5 Q3UYK7
Position
5 E5; 5 50.55 cM
AA seq 650 aa
MKAVLLLLCALGTAVAIPTSTRFLSDHSNPTTATLVTPEDATVPIAGVEATADIENHPSD
KAEKPSALNSEEETHEQSTEQDKTYSFEVDLKDEEDGDGDLSVDPTEGTLTLDLQEGTSE
PQQKSLPENGDFPATVSTSYVDPNQRANITKGKESQEQPVSDSHQQPNESSKQTQDLKAE
ESQTQDPDIPNEEEEEEEDEEEEEEEEPEDIGAPSDNQEEGKEPLEEQPTSKWEGNREQS
DDTLEESSQPTQISKTEKHQSEQGNQGQESDSEAEGEDKAAGSKEHIPHTEQQDQEGKAG
LEAIGNQKDTDEKAVSTEPTDAAVVPRSHGGAGDNGGGDDSKHGAGDDYFIPSQEFLEAE
RMHSLSYYLKYGGGEETTTGESENRREAADNQEAKKAESSPNAEPSDEGNSREHSAGSCT
NFQCKRGHICKTDPQGKPHCVCQDPETCPPAKILDQACGTDNQTYASSCHLFATKCRLEG
TKKGHQLQLDYFGACKSIPACTDFEVAQFPLRMRDWLKNILMQLYEPNPKHGGYLNEKQR
SKVKKIYLDEKRLLAGDHPIELLLRDFKKNYHMYVYPVHWQFNELDQHPADRILTHSELA
PLRASLVPMEHCITRFFEECDPNKDKHITLKEWGHCFGIKEEDIDENLLF
NT seq 1953 nt   +upstreamnt  +downstreamnt
atgaaggctgtgcttctcctcctgtgcgccttgggaaccgctgtggcaatcccgacaagt
acaaggtttctctctgaccactccaacccaactactgcaacactggtgacaccggaagac
gctacagtccccattgccggggttgaagctacagcagacatagaaaaccatcccagtgac
aaggctgaaaaaccttcagcacttaattcagaagaggaaactcatgaacagtcaacagag
caggacaaaacctacagcttcgaggtggacctgaaggatgaggaggatggagatggggat
ttaagtgtagatccaacggaaggaacactaacactggatctacaagaaggtacaagtgag
cctcaacagaaaagtctcccggagaacggcgatttccccgcgaccgtgtccacttcctat
gtggatcctaaccaacgcgcaaacatcacaaagggaaaggagagtcaggagcaacctgta
agtgactcacaccagcaaccgaatgaaagcagcaagcaaacccaagacttaaaggctgaa
gaaagccagacacaagatccagacattcccaatgaagaagaggaagaagaagaggacgaa
gaagaggaagaagaggaagagccggaagacattggtgcccccagtgataaccaagaggag
ggaaaagaacctctggaggagcagcctaccagcaagtgggaaggaaacagagagcaatct
gatgacaccttagaagagtccagtcagcccactcagataagcaagacagagaagcatcaa
tctgagcaaggaaaccaagggcaggagagtgactctgaggcagaaggagaggacaaggct
gcaggcagcaaggaacacattccacatacagagcagcaggaccaagaagggaaagctggc
cttgaagctattggcaaccagaaggacactgatgagaaggccgtttccacagaacctacc
gatgctgccgtggtgcctaggagtcacggaggagctggtgataacgggggcggggatgac
tctaagcatggtgcaggcgatgactacttcatccccagccaggaattcctagaggccgaa
aggatgcattccctctcctattacctcaaatatggcggcggcgaggagacaacgactggc
gagagtgagaaccggagggaggctgcagacaaccaagaggccaagaaagctgagagctca
ccaaatgctgaaccttcagatgagggcaactcaagggagcacagtgctggttcttgcacg
aacttccaatgtaaaaggggacacatttgcaaaaccgatccacaagggaaacctcactgt
gtttgccaagatccagagacttgtccccctgcaaaaatcctagatcaggcttgtggcact
gacaaccaaacctacgccagctcctgtcacctgtttgctaccaagtgcaggctggagggg
accaaaaagggacaccaactgcagctggattacttcggagcttgcaaatctattcctgct
tgtacggactttgaagtggctcagtttcccctgcggatgagagactggctcaaaaacatc
ctcatgcagctttatgaaccaaatcccaaacatggcggctatctcaatgaaaagcaaaga
agcaaagtcaaaaaaatttacctggatgagaagagactcttggctggagaccatcccatt
gaacttctcttgagggactttaagaaaaactaccacatgtatgtgtatcctgtgcactgg
cagtttaatgaactggaccagcatcctgcagacaggatcttgacacactctgaacttgct
cctctgcgagcttccctggtgcccatggaacactgcataactcgcttctttgaggagtgt
gaccccaacaaggataagcacatcaccttgaaggaatggggccactgctttggaattaaa
gaggaggatatagatgaaaacctcctcttttga

DBGET integrated database retrieval system