KEGG   Mus musculus (mouse): 13605Help
Entry
13605             CDS       T01002                                 

Gene name
Ect2, AI528536
Definition
(RefSeq) ect2 oncogene
  KO
K20704  protein ECT2
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    13605 (Ect2)
Membrane trafficking [BR:mmu04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    13605 (Ect2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RhoGEF PTCB-BRCT BRCT BRCT_2 LIG3_BRCT RTT107_BRCT_5 Ribosomal_L7Ae PGBA_C
Motif
Other DBs
NCBI-GeneID: 13605
NCBI-ProteinID: NP_031926
MGI: 95281
Ensembl: ENSMUSG00000027699
Vega: OTTMUSG00000021265
UniProt: Q07139
Structure
PDB: 

Position
3; 3 A3
AA seq 913 aa AA seqDB search
MADDSVLPSPSEITSLADSSVFDSKVAEMSKENLCLASTSNVDEEMPQVEARVIMVQDAG
KQEELLKALKTIKIMEVPVIKIKESCPGKSEEKLIKSIINMEMKVPCVKMDSMEEFESLD
SPEFENIFVVTDFQNSVFNDLYKADCRIVGPPVILNCAQRGEPLPFSCRPLYCTSMLNLV
LCFTGFRKKEELVKLVTLVHHMGGVIRKECNSKVTHLVANCTQGEKFRVAVSLGTPIMKP
EWIYKAWERRNEQCFCAAVDDFRNEFKVPPFQDCILSFLGFSDEEKHSMEEMTEMQGGSY
LPVGDERCTHLIVEENTVKDLPFEPSKKLFVVKQEWFWGSIQMDARAGETMYLYEKANTP
ELKKSVSLLSLSTPNSNRKRRRLKETLAQLSRETDLSPFPPRKRPSAEHSLSIGSLLDIS
NTPESSIHYGETPKSCAKSSRSSTPVPPKQSARWQVAKELYQTESNYVNILATIIQLFQV
PLEEEGQRGGPILAPEEIKTIFGSIPDIFDVHMKIKDDLEDLIANWDESRSIGDIFLKYA
KDLVKTYPPFVNFFEMSKEMIIKCEKQKPRFHAFLKINQAKPECGRQSLVELLIRPVQRL
PSVALLLNDLKKHTADENPDKSTLEKAIGSLKEVMTHINEDKRKTEAQKQIFDVVYEVDG
CPANLLSSHRSLVQRVETVSLGEHPCDRGEQVTLFLFNDCLEIARKRHKVIGTFRSPHDR
TRPPASLKHIHLMPLSQIKKVLDIRETEDCHNAFALLVRPPTEQANVLLSFQMTSEELPK
ESWLKMLCRHVANTICKADAENLMYVADPESFEVNTKDMDSTLSRASRAIKKTSKKVTRA
FSFSKTPKRALRMALSSSHSSEGRSPPSSGKLAVSRLSSTSSLAGIPSPSLVSLPSFFER
RSHTLSRSTTHLI
NT seq 2742 nt NT seq  +upstreamnt  +downstreamnt
atggctgacgacagcgtgttaccatctccttctgagataactagcttggcagactcttca
gtgtttgattctaaagttgctgaaatgtccaaggaaaacttgtgcttggcgtctacttca
aatgttgatgaagaaatgccgcaggttgaagcaagagtgataatggtccaggatgctggg
aaacaagaagaacttctaaaggccttaaagactattaagataatggaagtccctgttata
aagataaaagaaagttgtcctggaaaatcggaggaaaaattaataaaaagtattattaat
atggaaatgaaagtgccctgtgtaaagatggactcaatggaagaatttgaaagtttggat
tccccagaatttgagaatatatttgtagttactgacttccagaattctgtcttcaatgac
ttatacaaggctgattgtaggattgttgggccaccagttatactcaactgtgcacaaagg
ggagagcccttgccgttttcctgccggccgctgtattgtacgagtatgctgaacctggtg
ctctgcttcactggattcaggaagaaggaggagcttgtcaaattggtgacgttggttcat
catatgggtggagttattcgaaaagagtgtaattccaaagtaacacatctggtggcaaat
tgtacacaaggcgaaaaatttagggttgctgtgagcctgggcactccaattatgaagcca
gaatggatttataaagcgtgggaaagacgcaatgaacagtgtttctgtgcagcagttgat
gactttagaaatgaatttaaagttcctccattccaagattgcattttaagtttcctggga
ttttcagatgaagagaaacatagtatggaagaaatgactgaaatgcaaggaggtagctat
ttaccagttggggatgaaaggtgcactcaccttattgttgaagagaatacagtaaaggac
cttccattcgaaccttcaaagaaactttttgttgtcaagcaagagtggttctggggaagc
attcagatggacgctcgtgcaggagagactatgtatttgtatgaaaaggctaatactcct
gagctcaagaaatcggtgtctctgctttctctaagtactccaaacagcaaccgcaagaga
cggagattgaaagagaccctggctcagctctccagggagactgacctctctcctttccct
ccccggaagcggccctcagctgagcactctctttctattggctcactcctggatatctcc
aacacacccgagtccagcatccactatggagaaacaccgaagtcctgtgctaagtcttct
agaagttctactccagttcctccaaagcagtcagccaggtggcaggtggcgaaagagctc
taccagactgagagcaattatgtcaatatactggccacaatcattcaattatttcaggtg
cccttagaagaagaaggacagcgtggtgggcctattcttgcacctgaggagatcaagact
atttttgggagcatcccagatatctttgatgtgcatatgaagatcaaggatgatcttgaa
gaccttattgctaactgggatgagagcagaagtattggtgacatctttcttaaatatgca
aaagatttggtaaaaacctaccctccgtttgtaaacttctttgaaatgagcaaggaaatg
atcattaaatgtgagaaacaaaagcccagatttcatgctttcctcaagataaatcaagct
aaaccagaatgtggacgacagagccttgtggaacttctcatccggccagtgcagaggcta
cccagtgtcgctttacttttaaacgatcttaaaaagcatacagctgatgaaaatccagac
aaaagcactttagaaaaagctattggatcactaaaagaagtaatgacacatatcaatgag
gataagagaaaaacagaagcacagaagcaaatttttgatgttgtttatgaagtagatgga
tgcccagctaatctcttatcttctcatcggagcctggtgcaacgagtggaaacggtttcc
cttggtgagcacccttgcgaccgaggagaacaagtcactctcttcctcttcaatgactgc
ctcgagatagcaagaaagcggcacaaggttattggcacttttagaagtcctcacgaccgc
acccggccccccgcttctctgaagcacattcatctcatgcctctttctcagattaagaag
gtgctggacatccgagagacagaagattgtcacaatgcctttgccttgcttgtaaggcca
ccaacagaacaggccaatgtactgctcagcttccagatgacgtcagaggagcttccaaag
gagagctggctgaagatgctgtgccgacatgtagccaacaccatttgtaaggcagatgct
gagaatcttatgtatgtggctgatccagaatcctttgaagtaaatacaaaagatatggat
agtacattgagtcgagcatctagagcaataaagaagacttcaaaaaaggttacaagggca
ttctctttttccaaaactcccaagagagccctgcggatggctctttcatcatcccatagc
tcagagggaaggagtcctccgagcagtggcaagcttgctgtgagccgtctgtccagcaca
tcatccttagcaggtattccatctccctcccttgtcagcctcccttctttctttgaacgg
agaagtcatacattaagtcgatctacaactcacttgatatga

DBGET integrated database retrieval system