KEGG   Mus musculus (mouse): 13608Help
Entry
13608             CDS       T01002                                 

Gene name
Edar, ED1R, ED3, ED5, EDA-A1R, EDA3, dl
Definition
(RefSeq) ectodysplasin-A receptor
  KO
K05162  tumor necrosis factor receptor superfamily member EDAR
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    13608 (Edar)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    13608 (Edar)
Cytokine receptors [BR:mmu04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   13608 (Edar)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNFR_c6 OAD_gamma
Motif
Other DBs
NCBI-GeneID: 13608
NCBI-ProteinID: NP_034230
MGI: 1343498
Ensembl: ENSMUSG00000003227
Vega: OTTMUSG00000025045
UniProt: Q9R187
Position
10 B4; 10 29.37 cM
AA seq 448 aa AA seqDB search
MAHVGDCKWMSWLPVLVVSLMCSAKAEDSNCGENEYHNQTTGLCQQCPPCRPGEEPYMSC
GYGTKDDDYGCVPCPAEKFSKGGYQICRRHKDCEGFFRATVLTPGDMENDAECGPCLPGY
YMLENRPRNIYGMVCYSCLLAPPNTKECVGATSGVSAHSSSTSGGSTLSPFQHAHKELSG
QGHLATALIIAMSTIFIMAIAIVLIIMFYIMKTKPSAPACCSSPPGKSAEAPANTHEEKK
EAPDSVVTFPENGEFQKLTATPTKTPKSENDASSENEQLLSRSVDSDEEPAPDKQGSPEL
CLLSLVHLAREKSVTSNKSAGIQSRRKKILDVYANVCGVVEGLSPTELPFDCLEKTSRML
SSTYNSEKAVVKTWRHLAESFGLKRDEIGGMTDGMQLFDRISTAGYSIPELLTKLVQIER
LDAVESLCADILEWAGVVPPASPPPAAS
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atggcccacgtcggggactgcaaatggatgtcctggctcccagtgctggtggtgtctctg
atgtgctcagccaaggcggaggactccaactgtggtgagaacgaataccacaaccagact
accgggctgtgccagcagtgtcctccatgcagaccaggggaggagccctacatgtcctgt
ggatacggcactaaagacgacgactatggctgtgtgccctgccctgcagagaagttctcc
aaaggaggttatcagatatgcaggcgccacaaagactgtgagggcttcttccgggccact
gtgctgacaccaggagacatggaaaacgacgctgagtgtggcccatgtctccctggctac
tacatgctggaaaacagacccaggaacatctatggcatggtctgctactcctgtctcttg
gcacctcccaacaccaaggaatgtgtgggagccacttctggggtttcagcacactcatcc
agcacttccggtggcagcaccttgtctcccttccagcatgctcacaaagagctctcaggc
caaggacacctggccaccgccctgattattgccatgtctacgatcttcatcatggccatt
gccatcgtcctcatcatcatgttctacatcatgaagactaagccgtcagctccagcctgc
tgtagcagtcccccaggaaagagcgcagaagccccagctaacacacacgaggagaaaaaa
gaggccccagacagtgtggtgacgttccctgagaatggtgagttccagaagctgacagca
acacccacaaagacccccaaaagtgagaatgatgcctcctctgagaacgagcagttgcta
agtcgcagtgtggacagtgatgaagagccagccccggacaagcaggggtccccagagcta
tgtctgctgtcgctagttcacctggccagggagaagtctgtgaccagtaacaagtctgct
gggatccagagccggaggaaaaagatactggatgtgtatgccaacgtgtgtggtgttgtt
gaaggtctcagccccaccgagttgccgtttgactgccttgagaagacaagccgaatgctc
agctctacatacaactctgagaaggcggtcgtgaaaacatggcgccaccttgccgagagc
tttggactgaagagggatgagattgggggcatgactgatggcatgcagctctttgaccgc
atcagcaccgcgggctacagcatcccagagctgctcacaaagttggtgcagatcgagcgg
ctggatgctgtggagtccttgtgtgcagacatattggagtgggctggggttgtaccacct
gcctccccacccccagctgcgtcctga

DBGET integrated database retrieval system