KEGG   Mus musculus (mouse): 13616
Entry
13616             CDS       T01002                                 

Symbol
Edn3, ET-3, PPET3, ls, tmgc48
Name
(RefSeq) endothelin 3
  KO
K05227  endothelin-3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04024  cAMP signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04270  Vascular smooth muscle contraction
mmu04924  Renin secretion
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    13616 (Edn3)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    13616 (Edn3)
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    13616 (Edn3)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    13616 (Edn3)
SSDB
Motif
Pfam: Endothelin
Other DBs
NCBI-GeneID: 13616
NCBI-ProteinID: NP_031929
MGI: 95285
Ensembl: ENSMUSG00000027524
Vega: OTTMUSG00000016515
UniProt: P48299 A2APU5
Position
2 H4; 2 98.1 cM
AA seq 214 aa
MEPGLWLLLGLTVTSAAGLVPCPQSGDSGRASVSQGPPEAGSERGCEETVAGPGERIVSP
TVALPAQPESAGQERAPGRSGKQEDKGLPAHHRPRRCTCFTYKDKECVYYCHLDIIWINT
PEQTVPYGLSNYRESLRGKRSLGPVPESSQPSPWTRLRCTCMGADDKACAHFCARTRDVT
SYSGRAERPAAEEMRETGGPRQRLMSRTDKAHRP
NT seq 645 nt   +upstreamnt  +downstreamnt
atggagccggggctgtggctccttctcgggctcacagtgacctccgctgcaggacttgtg
ccttgcccccagtctggggactctggcagagccagtgtgtcccagggtccccctgaagct
ggatcagagaggggctgtgaagagactgtggctggccctggtgagaggattgtgtcccca
acagttgcactgcctgcacagcctgaaagcgctgggcaggaacgggcaccaggcaggtct
gggaaacaagaggacaaggggctgcctgcacaccaccgccctcgccgctgcacgtgcttc
acttacaaggacaaggagtgtgtctactattgccacctggacatcatctggattaacact
cctgaacagactgtgccctatggactgtccaactacagagaaagccttcggggaaagagg
tccttggggccagttccagaaagctcccagccttctccgtggacacgcttgcgttgtact
tgtatgggggcggatgacaaggcctgtgcacacttctgtgcacgcaccagagatgtcacc
agttattccgggagagcagaaaggccagctgcagaagagatgcgggagactggaggccca
cgtcaaaggttgatgtcaaggacagataaagcccaccggccttag

DBGET integrated database retrieval system