KEGG   Mus musculus (mouse): 13617
Entry
13617             CDS       T01002                                 

Symbol
Ednra, AEA001, ET-AR, ETa, Gpcr10, Mhdaaea1
Name
(RefSeq) endothelin receptor type A
  KO
K04197  endothelin receptor type A
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04020  Calcium signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04024  cAMP signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04270  Vascular smooth muscle contraction
mmu04924  Renin secretion
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    13617 (Ednra)
   04024 cAMP signaling pathway
    13617 (Ednra)
   04022 cGMP-PKG signaling pathway
    13617 (Ednra)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    13617 (Ednra)
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    13617 (Ednra)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    13617 (Ednra)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    13617 (Ednra)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    13617 (Ednra)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Peptide
   Endothelin
    13617 (Ednra)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4
Other DBs
NCBI-GeneID: 13617
NCBI-ProteinID: NP_034462
MGI: 105923
Ensembl: ENSMUSG00000031616
Vega: OTTMUSG00000024406
UniProt: Q61614
Position
8; 8 C1
AA seq 427 aa
MSIFCLAAYFWLTMVGGVMADNPERYSANLSSHMEDFTPFPGTEINFLGTTHRPPNLALP
SNGSMHGYCPQQTKITTAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIA
SLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALS
VDRYRAVASWSRVQGIGIPLITAIEIVSIWILSFILAIPEAIGFVMVPFEYKGELHRTCM
LNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQ
RREVAKTVFCLVVIFALCWFPLHLSRILKKTVYDEMDKNRCELLSFLLLMDYIGINLATM
NSCINPIALYFVSKKFKNCFQSCLCCCCHQSKSLMTSVPMNGTSIQWKNQEQNNHNTERS
SHKDSMN
NT seq 1284 nt   +upstreamnt  +downstreamnt
atgagtatcttttgccttgcggcatacttttggctgaccatggtgggaggcgtaatggct
gacaatccggagagatacagcgctaatctaagcagccacatggaagacttcacccctttt
ccggggacggagatcaactttctgggcaccacccatcgaccccctaatttggccctgcct
agcaatggctcaatgcacggctattgcccacagcagactaaaatcacgacagctttcaaa
tatattaacactgtgatatcctgcaccattttcatcgtgggaatggtggggaacgcaact
ctactacgaatcatttaccaaaacaagtgtatgaggaacggccccaatgcgctcatagcc
agcctggcccttggagaccttatctacgtggtcattgacctccccatcaacgtgtttaag
ctcttggcaggacgctggcctttcgaccacaatgattttggagtgtttctctgcaagctg
ttccccttcctgcagaagtcctccgtgggcatcaccgtcttgaacctctgtgctctcagt
gtggacaggtacagagcagtggcttcctggagccgagttcaaggaatcgggatccccttg
attaccgccattgaaatcgtctccatctggattctttccttcatcttggccatcccggaa
gcaatcggcttcgtcatggtacccttcgaatacaagggcgagctgcataggacctgcatg
ctcaacgccacgtccaagttcatggagttttaccaagatgtgaaggactggtggctcttt
gggttctacttctgcatgcccttggtgtgcacagcaatcttctacaccctcatgacctgt
gagatgctcaacaggaggaacggcagcttgcggatcgcccttagtgagcacctcaaacag
cgtcgagaagtggcaaagactgtcttctgcttggttgtcatcttcgccctgtgctggttc
cctcttcacttaagccgcattttgaagaaaactgtatatgatgagatggataagaaccgg
tgtgaactgctcagcttcttgctgctaatggattacatcggcattaacctggcaaccatg
aattcttgcataaacccaatagctctatattttgtgagcaagaaattcaaaaattgtttt
cagtcctgcctctgttgctgttgtcaccagtccaaaagcctcatgacctcggtccccatg
aatggaacgagtatccagtggaagaaccaagagcagaacaaccacaacacggaacggagc
agccacaaggacagcatgaactaa

DBGET integrated database retrieval system