KEGG   Mus musculus (house mouse): 13626
Entry
13626             CDS       T01002                                 
Symbol
Eed, l(7)5Rn, l7Rn5, lusk
Name
(RefSeq) embryonic ectoderm development
  KO
K11462  polycomb protein EED
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    13626 (Eed)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb group proteins
    PRC2-EZH1 complex
     13626 (Eed)
    PRC2-EZH2 complex
     13626 (Eed)
SSDB
Motif
Pfam: WD40 Nup160 NBCH_WD40
Other DBs
NCBI-GeneID: 13626
NCBI-ProteinID: NP_068676
MGI: 95286
Ensembl: ENSMUSG00000030619
UniProt: Q921E6
Structure
Position
7:complement(89603862..89630184)
AA seq 441 aa
MSEREVSTAPAGTDMPAAKKQKLSSDENSNPDLSGDENDDAVSIESGTNTERPDTPTNTP
NAPGRKSWGKGKWKSKKCKYSFKCVNSLKEDHNQPLFGVQFNWHSKEGDPLVFATVGSNR
VTLYECHSQGEIRLLQSYVDADADENFYTCAWTYDSNTSHPLLAVAGSRGIIRIINPITM
QCIKHYVGHGNAINELKFHPRDPNLLLSVSKDHALRLWNIQTDTLVAIFGGVEGHRDEVL
SADYDLLGEKIMSCGMDHSLKLWRINSKRMMNAIKESYDYNPNKTNRPFISQKIHFPDFS
TRDIHRNYVDCVRWLGDLILSKSCENAIVCWKPGKMEDDIDKIKPSESNVTILGRFDYSQ
CDIWYMRFSMDFWQKMLALGNQVGKLYVWDLEVEDPHKAKCTTLTHHKCGAAIRQTSFSR
DSSILIAVCDDASIWRWDRLR
NT seq 1326 nt   +upstreamnt  +downstreamnt
atgtccgagagggaagtgtcgactgcgccggcgggaacagacatgcccgcggccaagaag
cagaagttgagcagcgacgagaacagcaacccggacctctcgggagacgaaaatgacgat
gctgtcagtattgagagtggcacaaacacagaacgcccggacacgcccacaaatacgcca
aatgcaccaggaaggaaaagctggggaaagggaaaatggaagtcaaagaaatgcaaatat
tctttcaaatgtgtgaacagcctcaaggaagatcataaccagccattgtttggagttcag
tttaactggcacagtaaagaaggagaccctctggtgtttgcaactgtgggaagcaacaga
gtaaccttatacgaatgccattcacagggggagatacggttattgcagtcctatgtagat
gctgatgcagatgaaaacttttacacttgtgcatggacctatgatagcaacaccagccac
cctctattagcagttgctggatctagaggcattataagaataattaatcctataacaatg
cagtgtataaagcactatgttggccatggaaatgctatcaatgagctgaaattccaccca
cgagacccaaaccttctcctgtcagtaagtaaagatcatgctttacggttatggaatatc
caaacagacactcttgtggcaatattcggaggtgtggaagggcacagagatgaagttctg
agtgctgattatgatcttttgggtgaaaaaataatgtcctgtggtatggatcactctctt
aaactgtggagaatcaactcaaagaggatgatgaatgcaattaaggagtcttatgattat
aacccaaacaaaactaacaggccatttatttcccagaaaatccactttcctgacttttct
accagagacatacataggaattatgttgattgtgtgcgatggttaggcgatttgatactt
tccaagtcttgtgaaaatgccattgtatgctggaaacctggcaaaatggaggatgatata
gataaaattaaacctagtgagtctaatgtgactattcttgggcgatttgattacagccag
tgtgacatttggtacatgaggttttctatggatttctggcaaaagatgcttgcattgggc
aatcaggttggcaaactgtatgtttgggatttagaagtagaagatcctcataaagccaaa
tgcacaacactgacccatcataaatgtggcgcggctattcgacaaaccagtttcagtagg
gatagcagcatcctcatagctgtctgcgatgatgccagcatttggcgatgggatcgactt
cgataa

DBGET integrated database retrieval system