KEGG   Mus musculus (mouse): 13627Help
Entry
13627             CDS       T01002                                 

Gene name
Eef1a1
Definition
(RefSeq) eukaryotic translation elongation factor 1 alpha 1
  KO
K03231  elongation factor 1-alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03013  RNA transport
mmu05134  Legionellosis
mmu05140  Leishmaniasis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    13627 (Eef1a1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    13627 (Eef1a1)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    13627 (Eef1a1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    13627 (Eef1a1)
   03016 Transfer RNA biogenesis [BR:mmu03016]
    13627 (Eef1a1)
   03012 Translation factors [BR:mmu03012]
    13627 (Eef1a1)
   04131 Membrane trafficking [BR:mmu04131]
    13627 (Eef1a1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    13627 (Eef1a1)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Trans-acting binding proteins
     13627 (Eef1a1)
Transfer RNA biogenesis [BR:mmu03016]
 Eukaryotic type
  tRNA transport factors
   tRNA export factors
    13627 (Eef1a1)
Translation factors [BR:mmu03012]
 Eukaryotic type
  Elongation factors
   13627 (Eef1a1)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Other CMA associated proteins
    13627 (Eef1a1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   13627 (Eef1a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 GTP_EFTU_D4 G-alpha
Motif
Other DBs
NCBI-GeneID: 13627
NCBI-ProteinID: NP_034236
MGI: 1096881
Ensembl: ENSMUSG00000037742
Vega: OTTMUSG00000019692
UniProt: P10126 Q58E64
Position
9; 9 E1
AA seq 462 aa AA seqDB search
MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL
DKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV
GEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKK
IGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGSASGTTLLEALDCILPPTR
PTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPVNVTTEVKSVEMHHEALS
EALPGDNVGFNVKNVSVKDVRRGNVAGDSKNDPPMEAAGFTAQVIILNHPGQISAGYAPV
LDCHTAHIACKFAELKEKIDRRSGKKLEDGPKFLKSGDAAIVDMVPGKPMCVESFSDYPP
LGRFAVRDMRQTVAVGVIKAVDKKAAGAGKVTKSAQKAQKAK
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaggaaaagactcacatcaacatcgtcgtaatcggacacgtagattccggcaag
tccaccacaaccggccacctgatctacaaatgtggtggaatcgacaagcgaaccatcgaa
aagtttgagaaggaggctgctgagatgggaaagggctccttcaagtacgcctgggtctta
gacaaactgaaagctgagcgtgagcgtggtatcactattgacatctccctgtggaaattc
gagaccagcaaatactatgtgaccatcattgatgccccaggacacagagacttcatcaaa
aacatgattacaggcacatcccaggctgactgtgctgtcctgattgttgctgctggtgtt
ggtgaatttgaagctggtatctccaagaacgggcagacccgcgagcatgctcttctggct
tacaccctgggtgtgaaacagctgattgttggtgtcaacaaaatggattccaccgagcca
ccatacagtcagaagagatacgaggaaatcgttaaggaagtcagcacctacattaagaaa
attggctacaaccctgacacagtagcatttgtgccaatttctggttggaatggtgacaac
atgctggagccaagtgctaatatgccttggttcaagggatggaaagtcacccgcaaagat
ggcagtgccagtggcaccacgctgctggaagctttggattgtatcctaccaccaactcgt
ccaactgacaagcccctgcgactgcccctccaggatgtctataaaattggaggcattggc
actgtccctgtgggccgagtggagactggtgttctcaagcctggcatggtggttaccttt
gctccagtcaatgtaacaactgaagtcaagtctgttgaaatgcaccatgaagctttgagt
gaagctcttcctggggacaatgtgggcttcaatgtaaagaacgtgtcggtcaaagatgtt
agacgaggcaatgttgctggtgacagcaaaaacgacccaccaatggaagcagctggcttc
actgctcaggtgattatcctgaaccatccaggccaaatcagtgctggctacgctcctgtt
ctggattgtcacacagcccacatagcatgcaagtttgctgagcttaaagaaaagatcgat
cgtcgttctggtaagaagctggaagatggccccaagttcctgaagtctggcgatgctgcc
attgttgatatggtccctggcaagcccatgtgtgttgagagcttctctgactaccctcca
cttggtcgctttgctgttcgtgacatgaggcagacagttgctgtgggtgtcatcaaagct
gtggacaagaaggctgctggagctggcaaagtcaccaagtctgcccagaaagctcagaag
gctaaatga

DBGET integrated database retrieval system