KEGG   Mus musculus (house mouse): 13628
Entry
13628             CDS       T01002                                 
Symbol
Eef1a2, EEF1AL, EF-1-alpha-2, Eef1a, S1, STN, wasted, wst
Name
(RefSeq) eukaryotic translation elongation factor 1 alpha 2
  KO
K03231  elongation factor 1-alpha
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu03013  Nucleocytoplasmic transport
mmu05134  Legionellosis
mmu05140  Leishmaniasis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 Nucleocytoplasmic transport
    13628 (Eef1a2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    13628 (Eef1a2)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    13628 (Eef1a2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    13628 (Eef1a2)
   03016 Transfer RNA biogenesis [BR:mmu03016]
    13628 (Eef1a2)
   03012 Translation factors [BR:mmu03012]
    13628 (Eef1a2)
   04131 Membrane trafficking [BR:mmu04131]
    13628 (Eef1a2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    13628 (Eef1a2)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Trans-acting binding proteins
     13628 (Eef1a2)
Transfer RNA biogenesis [BR:mmu03016]
 Eukaryotic type
  tRNA transport factors
   tRNA export factors
    13628 (Eef1a2)
Translation factors [BR:mmu03012]
 Eukaryotic type
  Elongation factors
   13628 (Eef1a2)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Other CMA associated proteins
    13628 (Eef1a2)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   13628 (Eef1a2)
SSDB
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 GTP_EFTU_D4 G-alpha
Other DBs
NCBI-GeneID: 13628
NCBI-ProteinID: NP_031932
MGI: 1096317
Ensembl: ENSMUSG00000016349
UniProt: P62631
Position
2:complement(180783551..180798808)
AA seq 463 aa
MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL
DKLKAERERGITIDISLWKFETTKYYITIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV
GEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPAYSEKRYDEIVKEVSAYIKK
IGYNPATVPFVPISGWHGDNMLEPSPNMPWFKGWKVERKEGNASGVSLLEALDTILPPTR
PTDKPLRLPLQDVYKIGGIGTVPVGRVETGILRPGMVVTFAPVNITTEVKSVEMHHEALS
EALPGDNVGFNVKNVSVKDIRRGNVCGDSKADPPQEAAQFTSQVIILNHPGQISAGYSPV
IDCHTAHIACKFAELKEKIDRRSGKKLEDNPKSLKSGDAAIVEMVPGKPMCVESFSQYPP
LGRFAVRDMRQTVAVGVIKNVEKKSGGAGKVTKSAQKAQKAGK
NT seq 1392 nt   +upstreamnt  +downstreamnt
atgggcaaggagaagacacacatcaacattgtggtcattggccacgtggactcaggcaag
tccaccacgacaggccacctcatctacaagtgtggtggcatcgacaagcggaccatcgag
aagtttgagaaggaggcagcagagatggggaagggctcttttaaatatgcctgggtgctg
gacaagctgaaggccgagcgggaacgaggcatcaccatcgacatctccctctggaagttt
gagaccaccaagtactacatcaccatcatcgatgctccaggacaccgagacttcatcaag
aatatgattacaggcacatcccaggcggactgcgcagtgctgatcgtggcagccggtgtg
ggcgagtttgaggcgggcatctccaagaacgggcaaacccgggaacacgcactcctggcc
tacactctgggtgtgaagcagctcattgtgggtgtcaacaagatggactccacggaacca
gcctacagcgagaagcgctatgatgagattgttaaggaggtcagcgcctacatcaagaag
atcggctacaacccagccacggtgcccttcgtgcccatctcgggctggcatggtgacaac
atgctggagccttcacctaatatgccatggttcaagggctggaaagtagagcgtaaggaa
ggaaatgcaagcggcgtgtccctgctggaagccctggacacaatcctgccccccacccgc
cccactgacaagccccttcgtctgcctctgcaggatgtgtacaagattgggggcattggg
accgtgcctgtgggccgagtggagaccggtatcctccggcctggtatggtggtgaccttt
gcgccagtcaacatcaccacagaggtgaagtctgtggaaatgcaccatgaggcacttagc
gaggccctgcctggtgacaatgtcgggttcaatgtgaagaatgtgtccgttaaggatatt
cgccggggcaatgtctgcggggacagcaaagctgacccgcctcaggaggctgcccagttc
acctctcaggttatcatcctgaaccaccctgggcaaatcagcgctggctactcgccagtc
atcgactgtcacacggcccacattgcctgcaagtttgccgagctaaaggagaagattgac
cgtcgttctggcaagaagctggaggataaccccaagtccctgaagtctggtgatgcagcc
attgttgagatggtccctggaaaacccatgtgtgtggagagcttctcacagtacccacct
ctcggccgcttcgccgtgcgcgacatgcggcagactgtggccgtgggcgtcatcaagaac
gtggagaagaagagcggcggcgcaggcaaggtcaccaagtccgcacagaaggctcagaaa
gcgggcaagtga

DBGET integrated database retrieval system