KEGG   Mus musculus (mouse): 13641
Entry
13641             CDS       T01002                                 

Gene name
Efnb1, Cek5-, Cek5-L, EFL-, EFL-3, Elk, Elk-L, Ep, Epl, Epl2, Eplg2, LERK, LERK-2, Ler, Lerk2, St, Stra1
Definition
(RefSeq) ephrin B1
  KO
K05463  ephrin-B
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    13641 (Efnb1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    13641 (Efnb1)
   04052 Cytokines and growth factors [BR:mmu04052]
    13641 (Efnb1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   13641 (Efnb1)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   13641 (Efnb1)
Motif
Pfam: Ephrin DUF4381 DUF1180 Syndecan Cadherin_C_2 PalH Baculo_11_kDa TMEM132D_C
Other DBs
NCBI-GeneID: 13641
NCBI-ProteinID: NP_034240
MGI: 102708
Ensembl: ENSMUSG00000031217
Vega: OTTMUSG00000018065
UniProt: P52795 Q544L9
Structure
PDB: 
6P7S

Position
X C3; X 43.22 cM
AA seq 345 aa
MARPGQRWLSKWLVAMVVLTLCRLATPLAKNLEPVSWSSLNPKFLSGKGLVIYPKIGDKL
DIICPRAEAGRPYEYYKLYLVRPEQAAACSTVLDPNVLVTCNKPHQEIRFTIKFQEFSPN
YMGLEFKKYHDYYITSTSNGSLEGLENREGGVCRTRTMKIVMKVGQDPNAVTPEQLTTSR
PSKESDNTVKTATQAPGRGSQGDSDGKHETVNQEEKSGPGAGGGGSGDSDSFFNSKVALF
AAVGAGCVIFLLIIIFLTVLLLKLRKRHRKHTQQRAAALSLSTLASPKGGSGTAGTEPSD
IIIPLRTTENNYCPHYEKVSGDYGHPVYIVQEMPPQSPANIYYKV
NT seq 1038 nt   +upstreamnt  +downstreamnt
atggcccggcctgggcagcgttggctcagcaagtggcttgtggctatggtcgtgctgacg
ctgtgccggcttgccacgccgttggccaagaacctggagcccgtgtcctggagctctctt
aaccctaagttcctaagtgggaagggcttggtgatctacccgaagattggagacaagctg
gacatcatctgcccccgagcagaagcagggcggccctacgagtactacaagctgtacctg
gtgcggccagagcaggcggctgcttgcagcactgtgcttgatcccaatgtactggtcact
tgcaacaagccacaccaggaaatccgcttcaccatcaagttccaagagttcagccccaac
tacatgggcctggaattcaaaaagtaccacgattactacattacatcaacgtccaatggg
agcttggagggactggagaaccgggagggaggtgtgtgtcgcacccgcactatgaagatc
gttatgaaggttgggcaagatccaaatgctgtgacacccgagcagttgactaccagccgg
ccaagcaaggagtcagacaacactgtcaagacagccacacaggctcctggtcggggatcc
cagggtgactctgacggcaagcatgagactgtgaaccaggaagagaagagtggcccaggt
gcaggtggcggtggcagcggggactctgacagcttcttcaactccaaggtagcattgttc
gcagccgtcggcgccggctgtgtcatcttcctgctcatcatcatcttcttgacagtccta
ctactcaagctccgcaagcgccatcgcaagcatacacagcagcgggcggctgccctctcg
ctcagtaccctagccagccccaaagggggtagtggtacagcgggcaccgagcccagcgac
atcatcatccccttacggactacagagaacaactactgcccccactatgagaaggtgagt
ggggactacgggcatcctgtctacatcgtccaggagatgccccctcagagcccggcgaac
atctactacaaggtttga

DBGET integrated database retrieval system