KEGG   Mus musculus (mouse): 13643Help
Entry
13643             CDS       T01002                                 

Gene name
Efnb3, EFL-6, ELF-3, Elk-L3, Epl8, LERK-8, NLERK-2
Definition
(RefSeq) ephrin B3
  KO
K05463  ephrin-B
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    13643 (Efnb3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    13643 (Efnb3)
   04052 Cytokines and growth factors [BR:mmu04052]
    13643 (Efnb3)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   13643 (Efnb3)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   13643 (Efnb3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ephrin
Motif
Other DBs
NCBI-GeneID: 13643
NCBI-ProteinID: NP_031937
MGI: 109196
Ensembl: ENSMUSG00000003934
Vega: OTTMUSG00000005987
UniProt: O35393 Q543Q7
Structure
PDB: 

Position
11 B3; 11 42.8 cM
AA seq 340 aa AA seqDB search
MGAPHFGPGGVQVGALLLLGFAGLVSGLSLEPVYWNSANKRFQAEGGYVLYPQIGDRLDL
LCPRARPPGPHSSPSYEFYKLYLVEGAQGRRCEAPPAPNLLLTCDRPDLDLRFTIKFQEY
SPNLWGHEFRSHHDYYIIATSDGTREGLESLQGGVCLTRGMKVLLRVGQSPRGGAVPRKP
VSEMPMERDRGAAHSAEPGRDTIPGDPSSNATSRGAEGPLPPPSMPAVAGAAGGMALLLL
GVAGAGGAMCWRRRRAKPSESRHPGPGSFGRGGSLGLGGGGGMGPREAEPGELGIALRGG
GTADPPFCPHYEKVSGDYGHPVYIVQDGPPQSPPNIYYKV
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgggggccccccattttgggccagggggtgtgcaagtcggggccctgctgctgttaggt
tttgcggggctggtatctggactcagcctggagcctgtctactggaactcggcgaataag
aggttccaggcagagggcggttacgtgctttatcctcagatcggggaccggctagatcta
ctttgtccccgggctcggcctcctggcccccactcctctcctagttatgagttctacaaa
ctgtacctggtagagggtgcccagggtcggcgttgtgaggcaccccctgccccaaacctt
cttctcacatgtgaccggccagacctggacctccgcttcaccatcaagttccaggaatac
agccctaacctctggggccacgagttccgatcccaccacgattactacataattgccaca
tcagacgggacccgggaaggccttgagagcttgcaaggaggcgtgtgcctaaccagaggc
atgaaggtgcttctgcgagtgggacaaagtccccgaggaggagctgtaccccgaaaacct
gtgtctgaaatgcccatggagagagacagaggggcagctcacagcgcggaacctgggagg
gacaccataccaggtgaccccagcagcaatgcaacctcccggggtgctgaaggccccctg
ccccctcccagcatgcccgcagtggctggggcagcaggggggatggcgctgctcttgctg
ggcgtggcaggggctgggggtgccatgtgttggcggagacggcgggccaagccttcggag
agtcgccaccctggtcctggctcctttgggaggggagggtctctgggcctgggtggtgga
ggagggatggggcctcgggaagctgagcctggggagctaggaatagccctgcggggtggt
gggactgcagacccccccttctgccctcactacgagaaggtgagcggtgactatgggcac
cctgtgtacattgtgcaggatgggcccccccagagccctccgaacatctattacaaggta
tga

DBGET integrated database retrieval system