KEGG   Mus musculus (mouse): 13645
Entry
13645             CDS       T01002                                 

Gene name
Egf, AI790464
Definition
(RefSeq) epidermal growth factor
  KO
K04357  epidermal growth factor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu04010  MAPK signaling pathway
mmu04012  ErbB signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04066  HIF-1 signaling pathway
mmu04068  FoxO signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04540  Gap junction
mmu04630  JAK-STAT signaling pathway
mmu04810  Regulation of actin cytoskeleton
mmu05160  Hepatitis C
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05210  Colorectal cancer
mmu05212  Pancreatic cancer
mmu05213  Endometrial cancer
mmu05214  Glioma
mmu05215  Prostate cancer
mmu05218  Melanoma
mmu05219  Bladder cancer
mmu05223  Non-small cell lung cancer
mmu05224  Breast cancer
mmu05226  Gastric cancer
mmu05231  Choline metabolism in cancer
mmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    13645 (Egf)
   04012 ErbB signaling pathway
    13645 (Egf)
   04014 Ras signaling pathway
    13645 (Egf)
   04015 Rap1 signaling pathway
    13645 (Egf)
   04630 JAK-STAT signaling pathway
    13645 (Egf)
   04066 HIF-1 signaling pathway
    13645 (Egf)
   04068 FoxO signaling pathway
    13645 (Egf)
   04020 Calcium signaling pathway
    13645 (Egf)
   04072 Phospholipase D signaling pathway
    13645 (Egf)
   04151 PI3K-Akt signaling pathway
    13645 (Egf)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    13645 (Egf)
   04540 Gap junction
    13645 (Egf)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    13645 (Egf)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    13645 (Egf)
   05231 Choline metabolism in cancer
    13645 (Egf)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    13645 (Egf)
  09162 Cancer: specific types
   05210 Colorectal cancer
    13645 (Egf)
   05212 Pancreatic cancer
    13645 (Egf)
   05226 Gastric cancer
    13645 (Egf)
   05214 Glioma
    13645 (Egf)
   05218 Melanoma
    13645 (Egf)
   05219 Bladder cancer
    13645 (Egf)
   05215 Prostate cancer
    13645 (Egf)
   05213 Endometrial cancer
    13645 (Egf)
   05224 Breast cancer
    13645 (Egf)
   05223 Non-small cell lung cancer
    13645 (Egf)
  09172 Infectious disease: viral
   05160 Hepatitis C
    13645 (Egf)
   05165 Human papillomavirus infection
    13645 (Egf)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    13645 (Egf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    13645 (Egf)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   13645 (Egf)
SSDB
Motif
Pfam: Ldl_recept_b FXa_inhibition EGF_CA cEGF EGF EGF_3 DUF5050 SGL Plasmod_Pvs28 EGF_MSP1_1 hEGF Tr-sialidase_C
Other DBs
NCBI-GeneID: 13645
NCBI-ProteinID: NP_034243
MGI: 95290
Ensembl: ENSMUSG00000028017
Vega: OTTMUSG00000054128
UniProt: P01132 Q3UWD7
Structure
PDB: 

Position
3 G3; 3 58.5 cM
AA seq 1217 aa
MPWGRRPTWLLLAFLLVFLKISILSVTAWQTGNCQPGPLERSERSGTCAGPAPFLVFSQG
KSISRIDPDGTNHQQLVVDAGISADMDIHYKKERLYWVDVERQVLLRVFLNGTGLEKVCN
VERKVSGLAIDWIDDEVLWVDQQNGVITVTDMTGKNSRVLLSSLKHPSNIAVDPIERLMF
WSSEVTGSLHRAHLKGVDVKTLLETGGISVLTLDVLDKRLFWVQDSGEGSHAYIHSCDYE
GGSVRLIRHQARHSLSSMAFFGDRIFYSVLKSKAIWIANKHTGKDTVRINLHPSFVTPGK
LMVVHPRAQPRTEDAAKDPDPELLKQRGRPCRFGLCERDPKSHSSACAEGYTLSRDRKYC
EDVNECATQNHGCTLGCENTPGSYHCTCPTGFVLLPDGKQCHELVSCPGNVSKCSHGCVL
TSDGPRCICPAGSVLGRDGKTCTGCSSPDNGGCSQICLPLRPGSWECDCFPGYDLQSDRK
SCAASGPQPLLLFANSQDIRHMHFDGTDYKVLLSRQMGMVFALDYDPVESKIYFAQTALK
WIERANMDGSQRERLITEGVDTLEGLALDWIGRRIYWTDSGKSVVGGSDLSGKHHRIIIQ
ERISRPRGIAVHPRARRLFWTDVGMSPRIESASLQGSDRVLIASSNLLEPSGITIDYLTD
TLYWCDTKRSVIEMANLDGSKRRRLIQNDVGHPFSLAVFEDHLWVSDWAIPSVIRVNKRT
GQNRVRLQGSMLKPSSLVVVHPLAKPGADPCLYRNGGCEHICQESLGTARCLCREGFVKA
WDGKMCLPQDYPILSGENADLSKEVTSLSNSTQAEVPDDDGTESSTLVAEIMVSGMNYED
DCGPGGCGSHARCVSDGETAECQCLKGFARDGNLCSDIDECVLARSDCPSTSSRCINTEG
GYVCRCSEGYEGDGISCFDIDECQRGAHNCGENAACTNTEGGYNCTCAGRPSSPGLSCPD
STAPSLLGEDGHHLDRNSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQT
RDLRWWELRHAGYGQKHDIMVVAVCMVALVLLLVLGMWGTYYYRTRKQLSNPPKNPCDEP
SGSVSSSGPNSSSGAAVASCPQPWFVVLEKHQDPKNGSLPADGTNGAVVDAGLSPSLQLG
SVHLTSWRQKPHIDGMGTGQSCWIPPSSDRGPQEIEGNSHLPSYRPVGPEKLHSLQSANG
SCHERAPDLPRQTEPVQ
NT seq 3654 nt   +upstreamnt  +downstreamnt
atgccctggggccgaaggccaacctggctgttgctcgccttcctgctggtgtttttaaag
attagcatactcagcgtcacagcatggcagaccgggaactgtcagccaggtcctctcgag
agaagcgagagaagcgggacttgtgccggtcctgcccccttcctagttttctcacaagga
aagagcatctctcggattgacccagatggaacaaatcaccagcaattggtggtggatgct
ggcatctcagcagacatggatattcattataaaaaagagagactctattgggtggatgta
gaaagacaagttttgctaagagttttccttaacgggacaggactagagaaagtgtgcaat
gtagagaggaaggtgtctgggctggccatagactggatagatgatgaagttctctgggta
gaccaacagaacggagtcatcaccgtaacagatatgacagggaaaaattcccgagttctt
ctaagttccttaaaacatccgtcaaatatagcagtggatccaatagagaggttgatgttt
tggtcttcagaggtgaccggcagccttcacagagcacacctcaaaggtgttgatgtaaaa
acactgctggagacagggggaatatcggtgctgactctggatgtcctggacaaacggctc
ttctgggttcaggacagtggcgaaggaagccacgcttacattcattcctgtgattatgag
ggtggctccgtccgtcttatcaggcatcaagcacggcacagtttgtcttcaatggccttt
tttggtgatcggatcttctactcagtgttgaaaagcaaggcgatttggatagccaacaaa
cacacggggaaggacacggtcaggattaacctccatccatcctttgtgacacctggaaaa
ctgatggtagtacaccctcgtgcacagcccaggacagaggacgctgctaaggatcctgac
cccgaacttctcaaacagaggggaagaccatgccgcttcggtctctgtgagcgagacccc
aagtcccactcgagcgcatgcgctgagggctacacgttaagccgagaccggaagtactgc
gaagatgtcaatgaatgtgccactcagaatcacggctgtactcttgggtgtgaaaacacc
cctggatcctatcactgcacatgccccacaggatttgttctgcttcctgatgggaaacaa
tgtcacgaacttgtttcctgcccaggcaacgtatcaaagtgcagtcatggctgtgtcctg
acatcagatggtccccggtgcatctgtcctgcaggttcagtgcttgggagagatgggaag
acttgcactggttgttcatcgcctgacaatggtggatgcagccagatctgtcttcctctc
aggccaggatcctgggaatgtgattgctttcctgggtatgacctacagtcagaccgaaag
agctgtgcagcttcaggaccacagccacttttactgtttgcaaattcccaggacatccga
cacatgcattttgatggaacagactacaaagttctgctcagccggcagatgggaatggtt
tttgccttggattatgaccctgtggaaagcaagatatattttgcacagacagccctgaag
tggatagagagggctaatatggatgggtcccagcgagaaagactgatcacagaaggagta
gatacgcttgaaggtcttgccctggactggattggccggagaatctactggacagacagt
gggaagtctgttgttggagggagcgatctgagcgggaagcatcatcgaataatcatccag
gagagaatctcgaggccgcgaggaatagctgtgcatccaagggccaggagactgttctgg
acggacgtagggatgtctccacggattgaaagcgcttcccttcaaggttccgaccgggtg
ctgatagccagctccaatctactggaacccagtggaatcacgattgactacttaacagac
actttgtactggtgtgacaccaagaggtctgtgattgaaatggccaatctggatggctcc
aaacgccgaagacttatccagaacgacgtaggtcaccccttctctctagccgtgtttgag
gatcacctgtgggtctcggattgggctatcccatcggtaataagggtgaacaagaggact
ggccaaaacagggtacgtcttcaaggcagcatgctgaagccctcgtcactggttgtggtc
catccattggcaaaaccaggtgcagatccctgcttatacaggaatggaggctgtgaacac
atctgccaagagagcctgggcacagctcggtgtttgtgtcgtgaaggttttgtgaaggcc
tgggatgggaaaatgtgtctccctcaggattatccaatcctgtcaggtgaaaatgctgat
cttagtaaagaggtgacatcactgagcaactccactcaggctgaagtaccagacgatgat
gggacagaatcttccacactagtggctgaaatcatggtgtcaggcatgaactatgaagat
gactgtggtcccggggggtgtggaagccatgctcgatgcgtttcagacggagagactgct
gagtgtcagtgtctgaaagggtttgccagggatggaaacctgtgttctgatatagatgag
tgtgtgctggctagatcggactgccccagcacctcgtccaggtgcatcaacactgaaggt
ggctacgtctgcagatgctcagaaggctacgaaggagacgggatctcctgtttcgatatt
gacgagtgccagcggggggcgcacaactgcggtgagaatgccgcctgcaccaacacggag
ggaggctacaactgcacctgcgcaggccgcccatcctcgcccggactgagttgccctgac
tctaccgcaccctctctccttggggaagatggccaccatttggaccgaaatagttatcca
ggatgcccatcctcatatgatggatactgcctcaatggtggcgtgtgcatgcatattgaa
tcactggacagctacacatgcaactgtgttattggctattctggggatcgatgccagact
cgagacctacgatggtgggaactgcgtcatgctggctacgggcagaagcatgacatcatg
gtggtggctgtctgcatggtggcactggtcctgctgctcgtcttggggatgtgggggact
tactactacaggactcggaagcagctatcaaaccccccaaagaacccttgtgatgagcca
agcggaagtgtgagcagcagcggacccaacagcagcagcggggcagctgtggcttcttgt
ccccaaccttggtttgtggtcctagagaaacaccaagaccccaagaatgggagtctgcct
gcggatggtacgaatggtgcagtagtagatgctggcctgtctccctccctgcagctcggg
tcagtgcatctgacttcatggagacagaagccccacatagatggaatgggcacagggcaa
agctgctggattccaccatcaagtgacagaggaccccaggaaatagagggaaactcccac
ctaccctcctacagacctgtggggccggagaagctgcattctctccagtcagctaatgga
tcgtgtcacgaaagggctccagacctgccacggcagacagagccagttcagtag

KEGG   Mus musculus (mouse): 14205
Entry
14205             CDS       T01002                                 

Gene name
Vegfd, AI325264, Fig, Figf, VEGF-, VEGF-D
Definition
(RefSeq) vascular endothelial growth factor D
  KO
K05449  vascular endothelial growth factor C/D
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04668  TNF signaling pathway
mmu04926  Relaxin signaling pathway
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    14205 (Vegfd)
   04014 Ras signaling pathway
    14205 (Vegfd)
   04015 Rap1 signaling pathway
    14205 (Vegfd)
   04668 TNF signaling pathway
    14205 (Vegfd)
   04020 Calcium signaling pathway
    14205 (Vegfd)
   04151 PI3K-Akt signaling pathway
    14205 (Vegfd)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    14205 (Vegfd)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    14205 (Vegfd)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14205 (Vegfd)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    14205 (Vegfd)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    14205 (Vegfd)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   14205 (Vegfd)
SSDB
Motif
Pfam: PDGF CXCXC
Other DBs
NCBI-GeneID: 14205
NCBI-ProteinID: NP_034346
MGI: 108037
Ensembl: ENSMUSG00000031380
Vega: OTTMUSG00000019516
UniProt: P97946
Position
X F5; X 76.35 cM
AA seq 358 aa
MYGEWGMGNILMMFHVYLVQGFRSEHGPVKDFSFERSSRSMLERSEQQIRAASSLEELLQ
IAHSEDWKLWRCRLKLKSLASMDSRSASHRSTRFAATFYDTETLKVIDEEWQRTQCSPRE
TCVEVASELGKTTNTFFKPPCVNVFRCGGCCNEEGVMCMNTSTSYISKQLFEISVPLTSV
PELVPVKIANHTGCKCLPTGPRHPYSIIRRSIQTPEEDECPHSKKLCPIDMLWDNTKCKC
VLQDETPLPGTEDHSYLQEPTLCGPHMTFDEDRCECVCKAPCPGDLIQHPENCSCFECKE
SLESCCQKHKIFHPDTCSCEDRCPFHTRTCASRKPACGKHWRFPKETRAQGLYSQENP
NT seq 1077 nt   +upstreamnt  +downstreamnt
atgtatggagaatggggaatggggaatatcctcatgatgttccatgtgtacttggtgcag
ggcttcaggagcgaacatggaccagtgaaggatttttcttttgagcgatcatcccggtcc
atgttggaacgatctgaacaacagatccgagcagcttctagtttggaggagttgctgcaa
atcgcgcactctgaggactggaagctgtggcgatgccggttgaagctcaaaagtcttgcc
agtatggactcacgctcagcatcccatcgctccaccagatttgcggcaactttctatgac
actgaaacactaaaagttatagatgaagaatggcagaggacccaatgcagccctagagag
acatgcgtagaagtcgccagtgagctggggaagacaaccaacacattcttcaagcccccc
tgtgtaaatgtcttccggtgtggaggctgctgcaacgaagagggtgtgatgtgtatgaac
acaagcacctcctacatctccaaacagctctttgagatatcagtgcctctgacatcagtg
cccgagttagtgcctgttaaaattgccaaccatacgggttgtaagtgcttgcccacgggc
ccccgccatccttactcaattatcagaagatccattcagaccccagaagaagatgaatgt
cctcattccaagaaactctgtcctattgacatgctgtgggataacaccaaatgtaaatgt
gttttgcaagacgagactccactgcctgggacagaagaccactcttacctccaggaaccc
actctctgtggaccgcacatgacgtttgatgaagatcgctgtgagtgcgtctgtaaagca
ccatgtccgggagatctcattcagcacccggaaaactgcagttgctttgagtgcaaagaa
agtctggagagctgctgccaaaagcacaagatttttcacccagacacctgcagctgtgag
gacagatgtccttttcacaccagaacatgtgcaagtagaaagccagcctgtggaaagcac
tggcgctttccaaaggagacaagggcccagggactctacagccaggagaacccttga

KEGG   Mus musculus (mouse): 15234
Entry
15234             CDS       T01002                                 

Gene name
Hgf, C230052L06Rik, HGF/S, HGF/SF, NK, NK1, NK2, SF, SF/HG, SF/HGF
Definition
(RefSeq) hepatocyte growth factor
  KO
K05460  hepatocyte growth factor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu05144  Malaria
mmu05200  Pathways in cancer
mmu05205  Proteoglycans in cancer
mmu05211  Renal cell carcinoma
mmu05218  Melanoma
mmu05223  Non-small cell lung cancer
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    15234 (Hgf)
   04014 Ras signaling pathway
    15234 (Hgf)
   04015 Rap1 signaling pathway
    15234 (Hgf)
   04020 Calcium signaling pathway
    15234 (Hgf)
   04151 PI3K-Akt signaling pathway
    15234 (Hgf)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    15234 (Hgf)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    15234 (Hgf)
   05205 Proteoglycans in cancer
    15234 (Hgf)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    15234 (Hgf)
   05226 Gastric cancer
    15234 (Hgf)
   05218 Melanoma
    15234 (Hgf)
   05211 Renal cell carcinoma
    15234 (Hgf)
   05223 Non-small cell lung cancer
    15234 (Hgf)
  09174 Infectious disease: parasitic
   05144 Malaria
    15234 (Hgf)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    15234 (Hgf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    15234 (Hgf)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    15234 (Hgf)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   15234 (Hgf)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   15234 (Hgf)
SSDB
Motif
Pfam: Kringle Trypsin PAN_1 DUF1986 Ependymin DUF316
Other DBs
NCBI-GeneID: 15234
NCBI-ProteinID: NP_001276387
MGI: 96079
Ensembl: ENSMUSG00000028864
Vega: OTTMUSG00000055308
UniProt: Q08048 Q8C9G5
Structure
PDB: 
3HMR 2QJ4 4IUA

Position
5 A3; 5 7.07 cM
AA seq 728 aa
MMWGTKLLPVLLLQHVLLHLLLLHVAIPYAEGQKKRRNTLHEFKKSAKTTLTKEDPLLKI
KTKKVNSADECANRCIRNRGFTFTCKAFVFDKSRKRCYWYPFNSMSSGVKKGFGHEFDLY
ENKDYIRNCIIGKGGSYKGTVSITKSGIKCQPWNSMIPHEHSFLPSSYRGKDLQENYCRN
PRGEEGGPWCFTSNPEVRYEVCDIPQCSEVECMTCNGESYRGPMDHTESGKTCQRWDQQT
PHRHKFLPERYPDKGFDDNYCRNPDGKPRPWCYTLDPDTPWEYCAIKTCAHSAVNETDVP
METTECIQGQGEGYRGTSNTIWNGIPCQRWDSQYPHKHDITPENFKCKDLRENYCRNPDG
AESPWCFTTDPNIRVGYCSQIPKCDVSSGQDCYRGNGKNYMGNLSKTRSGLTCSMWDKNM
EDLHRHIFWEPDASKLNKNYCRNPDDDAHGPWCYTGNPLIPWDYCPISRCEGDTTPTIVN
LDHPVISCAKTKQLRVVNGIPTQTTVGWMVSLKYRNKHICGGSLIKESWVLTARQCFPAR
NKDLKDYEAWLGIHDVHERGEEKRKQILNISQLVYGPEGSDLVLLKLARPAILDNFVSTI
DLPSYGCTIPEKTTCSIYGWGYTGLINADGLLRVAHLYIMGNEKCSQHHQGKVTLNESEL
CAGAEKIGSGPCEGDYGGPLICEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIH
KVILTYKL
NT seq 2187 nt   +upstreamnt  +downstreamnt
atgatgtgggggaccaaacttctgccggtcctgttgctgcagcatgtcctcctgcacctc
ctcctgcttcatgtcgccatcccctatgcagaaggacagaagaaaagaagaaatacactt
catgaatttaaaaagtcagcaaaaactactcttaccaaggaagacccattactgaagatt
aaaaccaaaaaagtgaactctgcagatgagtgtgccaacaggtgtatcaggaacaggggc
tttacgttcacttgcaaggccttcgtttttgataagtcaagaaaacgatgctactggtat
cctttcaatagtatgtcaagtggagtgaaaaaagggtttggccatgaatttgacctctat
gaaaacaaagactatattagaaactgcatcattggtaaaggaggcagctataaagggacg
gtatccatcactaagagtggcatcaaatgccagccttggaattccatgatcccccatgaa
cacagctttttgccttcgagctatcgcggtaaagacctacaggaaaactactgtcgaaat
cctcgaggggaagaagggggaccctggtgtttcacaagcaatccagaggtacgctacgaa
gtctgtgacattcctcagtgttcagaagttgaatgcatgacctgcaatggtgaaagctac
agaggtcccatggatcacacagaatcaggcaagacttgtcagcgctgggaccagcagaca
ccacaccggcacaagttcttgccagaaagatatcccgacaagggctttgatgataattat
tgccgcaatcctgatggcaagccgaggccatggtgctacactcttgaccctgacacccct
tgggagtattgtgcaattaaaacgtgcgctcacagtgctgtgaatgagactgatgtccct
atggaaacaactgaatgcattcaaggccaaggagaaggttacaggggaaccagcaatacc
atttggaatggaattccctgtcagcgttgggattcgcagtaccctcacaagcatgatatc
actcccgagaacttcaaatgcaaggaccttagagaaaattattgccgcaatccagatggg
gctgaatcaccatggtgttttaccactgacccaaacatccgagttggctactgctctcaa
attcccaagtgtgacgtgtcaagtggacaagattgttatcgtggcaatgggaaaaattac
atgggcaacttatccaaaacaaggtctggacttacatgttccatgtgggacaagaatatg
gaggatttacaccgtcatatcttctgggagccagatgctagcaaattgaataagaattac
tgccggaatcctgatgatgatgcccatggaccttggtgctacacggggaatcctcttatt
ccttgggattattgccctatttcccgttgtgaaggagatactacacctacaattgtcaat
ttggaccatcctgtaatatcctgtgccaaaacaaaacaactgcgggttgtaaatggcatt
ccaacacaaacaacagtagggtggatggttagtttgaaatacagaaataaacatatctgt
ggaggatcattgataaaggaaagttgggttcttactgcaagacaatgttttccagccaga
aacaaagacttgaaagactatgaagcttggcttggcatccacgatgttcatgagagaggc
gaggagaagcgcaagcagatcttaaacatttcccagctggtctatggtcctgaaggctca
gacttggttttactgaagcttgctcgacctgcaatcctggataactttgtcagtacaatt
gatttacctagttatggttgtacaatccctgaaaagaccacttgcagtatttacggctgg
ggctacactggattgatcaacgcggatggtttattacgagtagctcatctgtatattatg
gggaatgagaaatgcagtcagcaccatcaaggcaaggtgactttgaatgagtctgagtta
tgtgctggggctgaaaagattggatcaggaccatgtgagggagattatggtggcccactc
atttgtgaacaacacaaaatgagaatggttcttggtgtcattgttcctggtcgtggatgt
gccatcccaaatcgtcctggtatttttgttcgagtagcatattatgcaaaatggatacac
aaagtaattttgacatacaagttgtaa

KEGG   Mus musculus (mouse): 16000
Entry
16000             CDS       T01002                                 

Gene name
Igf1, C730016P09Rik, Igf, Igf-, Igf-1, Igf-I
Definition
(RefSeq) insulin-like growth factor 1
  KO
K05459  insulin-like growth factor 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu01522  Endocrine resistance
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04066  HIF-1 signaling pathway
mmu04068  FoxO signaling pathway
mmu04114  Oocyte meiosis
mmu04115  p53 signaling pathway
mmu04150  mTOR signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04152  AMPK signaling pathway
mmu04211  Longevity regulating pathway
mmu04213  Longevity regulating pathway - multiple species
mmu04510  Focal adhesion
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu04730  Long-term depression
mmu04750  Inflammatory mediator regulation of TRP channels
mmu04913  Ovarian steroidogenesis
mmu04914  Progesterone-mediated oocyte maturation
mmu04935  Growth hormone synthesis, secretion and action
mmu04960  Aldosterone-regulated sodium reabsorption
mmu05200  Pathways in cancer
mmu05202  Transcriptional misregulation in cancer
mmu05205  Proteoglycans in cancer
mmu05214  Glioma
mmu05215  Prostate cancer
mmu05218  Melanoma
mmu05224  Breast cancer
mmu05410  Hypertrophic cardiomyopathy
mmu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    16000 (Igf1)
   04014 Ras signaling pathway
    16000 (Igf1)
   04015 Rap1 signaling pathway
    16000 (Igf1)
   04066 HIF-1 signaling pathway
    16000 (Igf1)
   04068 FoxO signaling pathway
    16000 (Igf1)
   04151 PI3K-Akt signaling pathway
    16000 (Igf1)
   04152 AMPK signaling pathway
    16000 (Igf1)
   04150 mTOR signaling pathway
    16000 (Igf1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    16000 (Igf1)
   04115 p53 signaling pathway
    16000 (Igf1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    16000 (Igf1)
   04550 Signaling pathways regulating pluripotency of stem cells
    16000 (Igf1)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    16000 (Igf1)
   04914 Progesterone-mediated oocyte maturation
    16000 (Igf1)
   04935 Growth hormone synthesis, secretion and action
    16000 (Igf1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    16000 (Igf1)
  09156 Nervous system
   04730 Long-term depression
    16000 (Igf1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    16000 (Igf1)
  09149 Aging
   04211 Longevity regulating pathway
    16000 (Igf1)
   04213 Longevity regulating pathway - multiple species
    16000 (Igf1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16000 (Igf1)
   05202 Transcriptional misregulation in cancer
    16000 (Igf1)
   05205 Proteoglycans in cancer
    16000 (Igf1)
  09162 Cancer: specific types
   05214 Glioma
    16000 (Igf1)
   05218 Melanoma
    16000 (Igf1)
   05215 Prostate cancer
    16000 (Igf1)
   05224 Breast cancer
    16000 (Igf1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    16000 (Igf1)
   05414 Dilated cardiomyopathy
    16000 (Igf1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    16000 (Igf1)
   01522 Endocrine resistance
    16000 (Igf1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    16000 (Igf1)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   16000 (Igf1)
SSDB
Motif
Pfam: Insulin
Other DBs
NCBI-GeneID: 16000
NCBI-ProteinID: NP_001104745
MGI: 96432
Ensembl: ENSMUSG00000020053
Vega: OTTMUSG00000031391
UniProt: P05017 Q4VJC0
Position
10 C1; 10 43.7 cM
AA seq 153 aa
MGKISSLPTQLFKICLCDFLKIKIHIMSSSHLFYLALCLLTFTSSTTAGPETLCGAELVD
ALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKAARS
IRAQRHTDMPKTQKEVHLKNTSRGSAGNKTYRM
NT seq 462 nt   +upstreamnt  +downstreamnt
atggggaaaatcagcagccttccaactcaattatttaagatctgcctctgtgacttcttg
aagataaagatacacatcatgtcgtcttcacacctcttctacctggcgctctgcttgctc
accttcaccagctccaccacagctggaccagagaccctttgcggggctgagctggtggat
gctcttcagttcgtgtgtggaccgaggggcttttacttcaacaagcccacaggctatggc
tccagcattcggagggcacctcagacaggcattgtggatgagtgttgcttccggagctgt
gatctgaggagactggagatgtactgtgccccactgaagcctacaaaagcagcccgctct
atccgtgcccagcgccacactgacatgcccaagactcagaaggaagtacatttgaagaac
acaagtagaggaagtgcaggaaacaagacctacagaatgtag

KEGG   Mus musculus (mouse): 18590
Entry
18590             CDS       T01002                                 

Gene name
Pdgfa, PDGF-1
Definition
(RefSeq) platelet derived growth factor, alpha
  KO
K04359  platelet-derived growth factor subunit A
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04540  Gap junction
mmu04630  JAK-STAT signaling pathway
mmu04810  Regulation of actin cytoskeleton
mmu05200  Pathways in cancer
mmu05202  Transcriptional misregulation in cancer
mmu05206  MicroRNAs in cancer
mmu05214  Glioma
mmu05215  Prostate cancer
mmu05218  Melanoma
mmu05231  Choline metabolism in cancer
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    18590 (Pdgfa)
   04014 Ras signaling pathway
    18590 (Pdgfa)
   04015 Rap1 signaling pathway
    18590 (Pdgfa)
   04630 JAK-STAT signaling pathway
    18590 (Pdgfa)
   04020 Calcium signaling pathway
    18590 (Pdgfa)
   04072 Phospholipase D signaling pathway
    18590 (Pdgfa)
   04151 PI3K-Akt signaling pathway
    18590 (Pdgfa)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    18590 (Pdgfa)
   04540 Gap junction
    18590 (Pdgfa)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    18590 (Pdgfa)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    18590 (Pdgfa)
   05202 Transcriptional misregulation in cancer
    18590 (Pdgfa)
   05206 MicroRNAs in cancer
    18590 (Pdgfa)
   05231 Choline metabolism in cancer
    18590 (Pdgfa)
  09162 Cancer: specific types
   05214 Glioma
    18590 (Pdgfa)
   05218 Melanoma
    18590 (Pdgfa)
   05215 Prostate cancer
    18590 (Pdgfa)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    18590 (Pdgfa)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    18590 (Pdgfa)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    18590 (Pdgfa)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    18590 (Pdgfa)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   18590 (Pdgfa)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   18590 (Pdgfa)
SSDB
Motif
Pfam: PDGF_N PDGF
Other DBs
NCBI-GeneID: 18590
NCBI-ProteinID: NP_032834
MGI: 97527
Ensembl: ENSMUSG00000025856
Vega: OTTMUSG00000025151
UniProt: P20033 Q99L56
Position
5 G2; 5 77.65 cM
AA seq 196 aa
MRTWACLLLLGCGYLAHALAEEAEIPRELIERLARSQIHSIRDLQRLLEIDSVGAEDALE
TSLRAHGSHAINHVPEKRPVPIRRKRSIEEAIPAVCKTRTVIYEIPRSQVDPTSANFLIW
PPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACA
TSNLNPDHREEETDVR
NT seq 591 nt   +upstreamnt  +downstreamnt
atgaggacctgggcttgcctgctgctcctcggctgcggatacctcgcccatgccctggcc
gaggaagccgagataccccgggagttgatcgagcggctggctcgaagtcagatccacagc
atccgggacctccagcgactcttggagatagactccgtaggggctgaggatgccttggag
acaagtctgagagcccatgggtcccatgccattaaccatgtgcccgagaagcggcctgtg
cccattcgcaggaagagaagtattgaggaagccattcctgcagtttgcaagaccaggacg
gtcatttacgagatacctcggagccaggtggaccccacatcggccaacttcctgatctgg
cccccatgtgtggaggtgaagcgctgcactggctgttgtaacaccagcagcgtcaagtgc
cagccttcacgggtccaccaccgcagtgtcaaggtggccaaagtggagtatgtcaggaag
aagccaaaattgaaagaggtccaggtgaggttagaggaacacctggagtgtgcatgtgcg
acctccaacctgaacccagaccatcgggaggaggagacagatgtgaggtga

KEGG   Mus musculus (mouse): 18591
Entry
18591             CDS       T01002                                 

Gene name
Pdgfb, PDGF-, PDGF-2, PDGF-B, Sis, c-sis
Definition
(RefSeq) platelet derived growth factor, B polypeptide
  KO
K17386  platelet-derived growth factor subunit B
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04540  Gap junction
mmu04630  JAK-STAT signaling pathway
mmu04810  Regulation of actin cytoskeleton
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05200  Pathways in cancer
mmu05206  MicroRNAs in cancer
mmu05211  Renal cell carcinoma
mmu05214  Glioma
mmu05215  Prostate cancer
mmu05218  Melanoma
mmu05231  Choline metabolism in cancer
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    18591 (Pdgfb)
   04014 Ras signaling pathway
    18591 (Pdgfb)
   04015 Rap1 signaling pathway
    18591 (Pdgfb)
   04630 JAK-STAT signaling pathway
    18591 (Pdgfb)
   04020 Calcium signaling pathway
    18591 (Pdgfb)
   04072 Phospholipase D signaling pathway
    18591 (Pdgfb)
   04151 PI3K-Akt signaling pathway
    18591 (Pdgfb)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    18591 (Pdgfb)
   04540 Gap junction
    18591 (Pdgfb)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    18591 (Pdgfb)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    18591 (Pdgfb)
   05206 MicroRNAs in cancer
    18591 (Pdgfb)
   05231 Choline metabolism in cancer
    18591 (Pdgfb)
  09162 Cancer: specific types
   05214 Glioma
    18591 (Pdgfb)
   05218 Melanoma
    18591 (Pdgfb)
   05211 Renal cell carcinoma
    18591 (Pdgfb)
   05215 Prostate cancer
    18591 (Pdgfb)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    18591 (Pdgfb)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    18591 (Pdgfb)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    18591 (Pdgfb)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    18591 (Pdgfb)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    18591 (Pdgfb)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   18591 (Pdgfb)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   18591 (Pdgfb)
SSDB
Motif
Pfam: PDGF PDGF_N
Other DBs
NCBI-GeneID: 18591
NCBI-ProteinID: NP_035187
MGI: 97528
Ensembl: ENSMUSG00000000489
UniProt: P31240 A0A0R4IZW4
Position
15 E1; 15 37.85 cM
AA seq 241 aa
MNRCWALFLPLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHRDSVDEDGAEL
DLNMTRAHSGVELESSSRGRRSLGSLAAAEPAVIAECKTRTEVFQISRNLIDRTNANFLV
WPPCVEVQRCSGCCNNRNVQCRASQVQMRPVQVRKIEIVRKKPIFKKATVTLEDHLACKC
ETVVTPRPVTRSPGTSREQRAKTPQARVTIRTVRIRRPPKGKHRKFKHTHDKAALKETLG
A
NT seq 726 nt   +upstreamnt  +downstreamnt
atgaatcgctgctgggcgctcttccttcctctctgctgctacctgcgtctggtcagcgcc
gagggggatcccattcctgaggaactgtatgaaatgctgagcgaccactccatccgctcc
tttgatgatcttcagcgcctgctgcacagagactccgtagatgaagatggggctgagctg
gacttgaacatgacccgagcacactccggagtcgagttggaaagctcatctcgagggagg
aggagcctagggtccctggcagcagcagagcctgctgtaatcgccgagtgcaagacgcgc
acagaggtgttccagatctctcggaacctcatcgatcgcaccaacgccaacttcctggtg
tggccgccctgtgtggaggtgcagcgctgctccggctgctgcaataaccgcaatgtgcaa
tgccgggcctcgcaggtgcagatgcggccggtccaggtgagaaagattgagattgtgcga
aagaagcccatcttcaagaaggccacagtgaccttggaggaccacctcgcctgcaagtgt
gagacagtagtgacccctcggcctgtgactagaagtcctgggacatccagggagcagcga
gccaagacgcctcaagctcgggtgaccattcggacggtgagaatccgccggccccccaaa
ggcaagcaccgaaagtttaagcacacccatgacaaggcggccctgaaggagaccctcgga
gcctag

KEGG   Mus musculus (mouse): 18654
Entry
18654             CDS       T01002                                 

Gene name
Pgf, AI854365, PI, PIGF, PL, Plgf
Definition
(RefSeq) placental growth factor
  KO
K16859  placenta growth factor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    18654 (Pgf)
   04014 Ras signaling pathway
    18654 (Pgf)
   04015 Rap1 signaling pathway
    18654 (Pgf)
   04151 PI3K-Akt signaling pathway
    18654 (Pgf)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    18654 (Pgf)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    18654 (Pgf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    18654 (Pgf)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   18654 (Pgf)
SSDB
Motif
Pfam: PDGF
Other DBs
NCBI-GeneID: 18654
NCBI-ProteinID: NP_032853
MGI: 105095
Ensembl: ENSMUSG00000004791
UniProt: P49764 Q544A5
Position
12 D1; 12 39.58 cM
AA seq 158 aa
MLVMKLFTCFLQVLAGLAVHSQGALSAGNNSTEVEVVPFNEVWGRSYCRPMEKLVYILDE
YPDEVSHIFSPSCVLLSRCSGCCGDEGLHCVPIKTANITMQILKIPPNRDPHFYVEMTFS
QDVLCECRPILETTKAERRKTKGKRKRSRNSQTEEPHP
NT seq 477 nt   +upstreamnt  +downstreamnt
atgctggtcatgaagctgttcacttgcttcttacaggtcctagctgggttggctgtgcat
tcccagggggccctgtctgctgggaacaactcaacagaagtggaagtggtgcctttcaac
gaagtgtggggtcgcagctactgtcggcccatggagaagctggtgtacatcttggatgaa
taccctgatgaggtgtctcacatattcagtccgtcctgtgtccttctgagtcgctgtagt
ggctgctgtggtgatgaaggtctgcactgtgtgccgataaagacagccaacatcactatg
cagatcttgaagattccccccaatcgggatccacatttctatgtggagatgacattttct
caggatgtgctctgtgaatgcagacctattctggagacgacaaaggcagaaaggaggaaa
accaaggggaagaggaagaggagtagaaactcacagactgaggaaccccacccgtga

KEGG   Mus musculus (mouse): 22339
Entry
22339             CDS       T01002                                 

Gene name
Vegfa, V, VEGF12, VEGF16, VEGF18, Veg, Vegf, Vpf
Definition
(RefSeq) vascular endothelial growth factor A
  KO
K05448  vascular endothelial growth factor A
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04066  HIF-1 signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04370  VEGF signaling pathway
mmu04510  Focal adhesion
mmu04926  Relaxin signaling pathway
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu05163  Human cytomegalovirus infection
mmu05165  Human papillomavirus infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05200  Pathways in cancer
mmu05205  Proteoglycans in cancer
mmu05206  MicroRNAs in cancer
mmu05211  Renal cell carcinoma
mmu05212  Pancreatic cancer
mmu05219  Bladder cancer
mmu05323  Rheumatoid arthritis
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    22339 (Vegfa)
   04014 Ras signaling pathway
    22339 (Vegfa)
   04015 Rap1 signaling pathway
    22339 (Vegfa)
   04370 VEGF signaling pathway
    22339 (Vegfa)
   04066 HIF-1 signaling pathway
    22339 (Vegfa)
   04020 Calcium signaling pathway
    22339 (Vegfa)
   04151 PI3K-Akt signaling pathway
    22339 (Vegfa)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    22339 (Vegfa)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    22339 (Vegfa)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    22339 (Vegfa)
   05206 MicroRNAs in cancer
    22339 (Vegfa)
   05205 Proteoglycans in cancer
    22339 (Vegfa)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    22339 (Vegfa)
   05211 Renal cell carcinoma
    22339 (Vegfa)
   05219 Bladder cancer
    22339 (Vegfa)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    22339 (Vegfa)
   05167 Kaposi sarcoma-associated herpesvirus infection
    22339 (Vegfa)
   05165 Human papillomavirus infection
    22339 (Vegfa)
  09163 Immune disease
   05323 Rheumatoid arthritis
    22339 (Vegfa)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    22339 (Vegfa)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    22339 (Vegfa)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    22339 (Vegfa)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    22339 (Vegfa)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    22339 (Vegfa)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   22339 (Vegfa)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   22339 (Vegfa)
SSDB
Motif
Pfam: VEGF_C PDGF Cnd1_N
Other DBs
NCBI-GeneID: 22339
NCBI-ProteinID: NP_001273985
MGI: 103178
Ensembl: ENSMUSG00000023951
Vega: OTTMUSG00000016285
UniProt: Q00731
Position
17 C; 17 22.79 cM
AA seq 214 aa
MNFLLSWVHWTLALLLYLHHAKWSQAAPTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDI
FQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMS
FLQHSRCECRPKKDRTKPEKKSVRGKGKGQKRKRKKSRFKSWSVHCEPCSERRKHLFVQD
PQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
NT seq 645 nt   +upstreamnt  +downstreamnt
atgaactttctgctctcttgggtgcactggaccctggctttactgctgtacctccaccat
gccaagtggtcccaggctgcacccacgacagaaggagagcagaagtcccatgaagtgatc
aagttcatggatgtctaccagcgaagctactgccgtccgattgagaccctggtggacatc
ttccaggagtaccccgacgagatagagtacatcttcaagccgtcctgtgtgccgctgatg
cgctgtgcaggctgctgtaacgatgaagccctggagtgcgtgcccacgtcagagagcaac
atcaccatgcagatcatgcggatcaaacctcaccaaagccagcacataggagagatgagc
ttcctacagcacagcagatgtgaatgcagaccaaagaaagacagaacaaagccagaaaaa
aaatcagttcgaggaaagggaaagggtcaaaaacgaaagcgcaagaaatcccggtttaaa
tcctggagcgttcactgtgagccttgttcagagcggagaaagcatttgtttgtccaagat
ccgcagacgtgtaaatgttcctgcaaaaacacagactcgcgttgcaaggcgaggcagctt
gagttaaacgaacgtacttgcagatgtgacaagccaaggcggtga

KEGG   Mus musculus (mouse): 22340
Entry
22340             CDS       T01002                                 

Gene name
Vegfb, V, VEGF-, VEGF-B, Vrf
Definition
(RefSeq) vascular endothelial growth factor B
  KO
K16858  vascular endothelial growth factor B
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04926  Relaxin signaling pathway
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    22340 (Vegfb)
   04014 Ras signaling pathway
    22340 (Vegfb)
   04015 Rap1 signaling pathway
    22340 (Vegfb)
   04020 Calcium signaling pathway
    22340 (Vegfb)
   04151 PI3K-Akt signaling pathway
    22340 (Vegfb)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    22340 (Vegfb)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    22340 (Vegfb)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    22340 (Vegfb)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    22340 (Vegfb)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    22340 (Vegfb)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   22340 (Vegfb)
SSDB
Motif
Pfam: PDGF
Other DBs
NCBI-GeneID: 22340
NCBI-ProteinID: NP_035827
MGI: 106199
Ensembl: ENSMUSG00000024962
Vega: OTTMUSG00000033015
UniProt: P49766
Position
19; 19 A
AA seq 207 aa
MSPLLRRLLLVALLQLARTQAPVSQFDGPSHQKKVVPWIDVYARATCQPREVVVPLSMEL
MGNVVKQLVPSCVTVQRCGGCCPDDGLECVPTGQHQVRMQILMIQYPSSQLGEMSLEEHS
QCECRPKKKESAVKPDRVAIPHHRPQPRSVPGWDSTPGASSPADIIHPTPAPGSSARLAP
SAVNALTPGPAAAAADAAASSIAKGGA
NT seq 624 nt   +upstreamnt  +downstreamnt
atgagccccctgctccgtcgcctgctgcttgttgcactgctgcagctggctcgcacccag
gcccctgtgtcccagtttgatggccccagccaccagaagaaagtggtgccatggatagac
gtttatgcacgtgccacatgccagcccagggaggtggtggtgcctctgagcatggaactc
atgggcaatgtggtcaaacaactagtgcccagctgtgtgactgtgcagcgctgtggtggc
tgctgccctgacgatggcctggaatgtgtgcccactgggcaacaccaagtccgaatgcag
atcctcatgatccagtacccgagcagtcagctgggggagatgtccctggaagaacacagc
caatgtgaatgcagaccaaaaaaaaaggagagtgctgtgaagccagacagggttgccata
ccccaccaccgtccccagccccgctctgttccgggctgggactctaccccgggagcatcc
tccccagctgacatcatccatcccactccagccccaggatcctctgcccgccttgcaccc
agcgccgtcaacgccctgacccccggacctgccgctgccgctgcagacgccgccgcttcc
tccattgccaagggcggggcttag

KEGG   Mus musculus (mouse): 22341
Entry
22341             CDS       T01002                                 

Gene name
Vegfc, AW228853, VEGF-, VEGF-C
Definition
(RefSeq) vascular endothelial growth factor C
  KO
K05449  vascular endothelial growth factor C/D
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04668  TNF signaling pathway
mmu04926  Relaxin signaling pathway
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    22341 (Vegfc)
   04014 Ras signaling pathway
    22341 (Vegfc)
   04015 Rap1 signaling pathway
    22341 (Vegfc)
   04668 TNF signaling pathway
    22341 (Vegfc)
   04020 Calcium signaling pathway
    22341 (Vegfc)
   04151 PI3K-Akt signaling pathway
    22341 (Vegfc)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    22341 (Vegfc)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    22341 (Vegfc)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    22341 (Vegfc)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    22341 (Vegfc)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    22341 (Vegfc)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   22341 (Vegfc)
SSDB
Motif
Pfam: PDGF CXCXC
Other DBs
NCBI-GeneID: 22341
NCBI-ProteinID: NP_033532
MGI: 109124
Ensembl: ENSMUSG00000031520
Vega: OTTMUSG00000060617
UniProt: P97953
Position
8; 8 B1.3
AA seq 415 aa
MHLLCFLSLACSLLAAALIPSPREAPATVAAFESGLGFSEAEPDGGEVKAFEGKDLEEQL
RSVSSVDELMSVLYPDYWKMYKCQLRKGGWQQPTLNTRTGDSVKFAAAHYNTEILKSIDN
EWRKTQCMPREVCIDVGKEFGAATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTGYLSKT
LFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRRSLPATLPQCQAANKTCP
TNYVWNNYMCRCLAQQDFIFYSNVEDDSTNGFHDVCGPNKELDEDTCQCVCKGGLRPSSC
GPHKELDRDSCQCVCKNKLFPNSCGANREFDENTCQCVCKRTCPRNQPLNPGKCACECTE
NTQKCFLKGKKFHHQTCSCYRRPCANRLKHCDPGLSFSEEVCRCVPSYWKRPHLN
NT seq 1248 nt   +upstreamnt  +downstreamnt
atgcacttgctgtgcttcttgtctctggcgtgttccctgctcgccgctgcgctgatcccc
agtccgcgcgaggcgcccgccaccgtcgccgccttcgagtcgggactgggcttctcggaa
gcggagcccgacgggggcgaggtcaaggcttttgaaggcaaagacctggaggagcagttg
cggtctgtgtccagcgtagatgagctgatgtctgtcctgtacccagactactggaaaatg
tacaagtgccagctgcggaaaggcggctggcagcagcccaccctcaataccaggacaggg
gacagtgtaaaatttgctgctgcacattataacacagagatcctgaaaagtattgataat
gagtggagaaagactcaatgcatgccacgtgaggtgtgtatagatgtggggaaggagttt
ggagcagccacaaacaccttctttaaacctccatgtgtgtccgtctacagatgtgggggt
tgctgcaacagcgaggggctgcagtgcatgaacaccagcacaggttacctcagcaagacg
ttgtttgaaattacagtgcctctctcacaaggccccaaaccagtcacaatcagttttgcc
aatcacacttcctgccggtgcatgtctaaactggatgtttacagacaagttcattcaatt
attagacgttctctgccagcaacattaccacagtgtcaggcagctaacaagacatgtcca
acaaactatgtgtggaataactacatgtgccgatgcctggctcagcaggattttatcttt
tattcaaatgttgaagatgactcaaccaatggattccatgatgtctgtggacccaacaag
gagctggatgaagacacctgtcagtgtgtctgcaagggggggcttcggccatctagttgt
ggaccccacaaagaactagatagagactcatgtcagtgtgtctgtaaaaacaaacttttc
cctaattcatgtggagccaacagggaatttgatgagaatacatgtcagtgtgtatgtaaa
agaacgtgtccaagaaatcagcccctgaatcctgggaaatgtgcctgtgaatgtacagaa
aacacacagaagtgcttccttaaagggaagaagttccaccatcaaacatgcagttgttac
agaagaccgtgtgcgaatcgactgaagcattgtgatccaggactgtcctttagtgaagaa
gtatgccgctgtgtcccatcgtattggaaaaggccacatctgaactaa

KEGG   Mus musculus (mouse): 54635
Entry
54635             CDS       T01002                                 

Gene name
Pdgfc, 1110064L01Rik, AI647969, PDGF-, PDGF-C, SCDGF, VEGF-E
Definition
(RefSeq) platelet-derived growth factor, C polypeptide
  KO
K05450  platelet derived growth factor C/D
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04540  Gap junction
mmu04810  Regulation of actin cytoskeleton
mmu05215  Prostate cancer
mmu05218  Melanoma
mmu05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    54635 (Pdgfc)
   04014 Ras signaling pathway
    54635 (Pdgfc)
   04015 Rap1 signaling pathway
    54635 (Pdgfc)
   04020 Calcium signaling pathway
    54635 (Pdgfc)
   04072 Phospholipase D signaling pathway
    54635 (Pdgfc)
   04151 PI3K-Akt signaling pathway
    54635 (Pdgfc)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    54635 (Pdgfc)
   04540 Gap junction
    54635 (Pdgfc)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    54635 (Pdgfc)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    54635 (Pdgfc)
  09162 Cancer: specific types
   05218 Melanoma
    54635 (Pdgfc)
   05215 Prostate cancer
    54635 (Pdgfc)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    54635 (Pdgfc)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    54635 (Pdgfc)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   54635 (Pdgfc)
SSDB
Motif
Pfam: CUB PDGF
Other DBs
NCBI-GeneID: 54635
NCBI-ProteinID: NP_064355
MGI: 1859631
Ensembl: ENSMUSG00000028019
Vega: OTTMUSG00000028878
UniProt: Q8CI19
Position
3; 3 E3
AA seq 345 aa
MLLLGLLLLTSALAGQRTGTRAESNLSSKLQLSSDKEQNGVQDPRHERVVTISGNGSIHS
PKFPHTYPRNMVLVWRLVAVDENVRIQLTFDERFGLEDPEDDICKYDFVEVEEPSDGSVL
GRWCGSGTVPGKQTSKGNHIRIRFVSDEYFPSEPGFCIHYSIIMPQVTETTSPSVLPPSS
LSLDLLNNAVTAFSTLEELIRYLEPDRWQVDLDSLYKPTWQLLGKAFLYGKKSKVVNLNL
LKEEVKLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPRK
VTKKYHEVLQLRPKTGVKGLHKSLTDVALEHHEECDCVCRGNAGG
NT seq 1038 nt   +upstreamnt  +downstreamnt
atgctcctcctcggcctcctcctgctgacatctgccctggccggccaaagaacggggact
cgggctgagtccaacctgagcagcaagttgcagctctccagcgacaaggaacagaacgga
gtgcaagatccccggcatgagagagttgtcactatatctggtaatgggagcatccacagc
ccgaagtttcctcatacatacccaagaaatatggtgctggtgtggagattagttgcagta
gatgaaaatgtgcggatccagctgacatttgatgagagatttgggctggaagatccagaa
gacgatatatgcaagtatgattttgtagaagttgaggagcccagtgatggaagtgtttta
ggacgctggtgtggttctgggactgtgccaggaaagcagacttctaaaggaaatcatatc
aggataagatttgtatctgatgagtattttccatctgaacccggattctgcatccactac
agtattatcatgccacaagtcacagaaaccacgagtccttcggtgttgcccccttcatct
ttgtcattggacctgctcaacaatgctgtgactgccttcagtaccttggaagagctgatt
cggtacctagagccagatcgatggcaggtggacttggacagcctctacaagccaacatgg
cagcttttgggcaaggctttcctgtatgggaaaaaaagcaaagtggtgaatctgaatctc
ctcaaggaagaggtaaaactctacagctgcacaccccggaacttctcagtgtccatacgg
gaagagctaaagaggacagataccatattctggccaggttgtctcctggtcaagcgctgt
ggaggaaattgtgcctgttgtctccataattgcaatgaatgtcagtgtgtcccacgtaaa
gttacaaaaaagtaccatgaggtccttcagttgagaccaaaaactggagtcaagggattg
cataagtcactcactgatgtggctctggaacaccacgaggaatgtgactgtgtgtgtaga
ggaaacgcaggagggtaa

KEGG   Mus musculus (mouse): 71785
Entry
71785             CDS       T01002                                 

Gene name
Pdgfd, 1110003I09Rik
Definition
(RefSeq) platelet-derived growth factor, D polypeptide
  KO
K05450  platelet derived growth factor C/D
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04540  Gap junction
mmu04810  Regulation of actin cytoskeleton
mmu05215  Prostate cancer
mmu05218  Melanoma
mmu05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    71785 (Pdgfd)
   04014 Ras signaling pathway
    71785 (Pdgfd)
   04015 Rap1 signaling pathway
    71785 (Pdgfd)
   04020 Calcium signaling pathway
    71785 (Pdgfd)
   04072 Phospholipase D signaling pathway
    71785 (Pdgfd)
   04151 PI3K-Akt signaling pathway
    71785 (Pdgfd)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    71785 (Pdgfd)
   04540 Gap junction
    71785 (Pdgfd)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    71785 (Pdgfd)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    71785 (Pdgfd)
  09162 Cancer: specific types
   05218 Melanoma
    71785 (Pdgfd)
   05215 Prostate cancer
    71785 (Pdgfd)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    71785 (Pdgfd)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    71785 (Pdgfd)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   71785 (Pdgfd)
SSDB
Motif
Pfam: CUB PDGF
Other DBs
NCBI-GeneID: 71785
NCBI-ProteinID: NP_082200
MGI: 1919035
Ensembl: ENSMUSG00000032006
Vega: OTTMUSG00000062234
UniProt: Q925I7
Position
9; 9 A1
AA seq 370 aa
MQRLVLVSILLCANFSCYPDTFATPQRASIKALRNANLRRDESNHLTDLYQREENIQVTS
NGHVQSPRFPNSYPRNLLLTWWLRSQEKTRIQLSFDHQFGLEEAENDICRYDFVEVEEVS
ESSTVVRGRWCGHKEIPPRITSRTNQIKITFKSDDYFVAKPGFKIYYSFVEDFQPEAASE
TNWESVTSSFSGVSYHSPSITDPTLTADALDKTVAEFDTVEDLLKHFNPVSWQDDLENLY
LDTPHYRGRSYHDRKSKVDLDRLNDDVKRYSCTPRNHSVNLREELKLTNAVFFPRCLLVQ
RCGGNCGCGTVNWKSCTCSSGKTVKKYHEVLKFEPGHFKRRGKAKNMALVDIQLDHHERC
DCICSSRPPR
NT seq 1113 nt   +upstreamnt  +downstreamnt
atgcaacggctcgttttagtctccattctcctgtgcgcgaactttagctgctatccggac
acttttgcgactccgcagagagcatccatcaaagctttgcgcaatgccaacctcaggaga
gatgagagcaatcacctcacagacttgtaccagagagaggagaacattcaggtgacaagc
aatggccatgtgcagagtcctcgcttcccgaacagctacccaaggaacctgcttctgaca
tggtggctccgttcccaggagaaaacacggatacaactgtcctttgaccatcaattcgga
ctagaggaagcagaaaatgacatttgtaggtatgactttgtggaagttgaagaagtctca
gagagcagcactgttgtcagaggaagatggtgtggccacaaggagatccctccaaggata
acgtcaagaacaaaccagattaaaatcacatttaagtctgatgactactttgtggcaaaa
cctggattcaagatttattattcatttgtggaagatttccaaccggaagcagcctcagag
accaactgggaatcagtcacaagctctttctctggggtgtcctatcactctccatcaata
acggaccccactctcactgctgatgccctggacaaaactgtcgcagaattcgataccgtg
gaagatctacttaagcacttcaatccagtgtcttggcaagatgatctggagaatttgtat
ctggacacccctcattatagaggcaggtcataccatgatcggaagtccaaagtggacctg
gacaggctcaatgatgatgtcaagcgttacagttgcactcccaggaatcactctgtgaac
ctcagggaggagctgaagctgaccaatgcagtcttcttcccacgatgcctcctcgtgcag
cgctgtggtggcaactgtggttgcggaactgtcaactggaagtcctgcacatgcagctca
gggaagacagtgaagaagtatcatgaggtattgaagtttgagcctggacatttcaagaga
aggggcaaagctaagaatatggctcttgttgatatccagctggatcatcatgagcgatgt
gactgtatctgcagctcaagaccacctcgataa

DBGET integrated database retrieval system