KEGG   Mus musculus (mouse): 13645
Entry
13645             CDS       T01002                                 

Gene name
Egf, AI790464
Definition
(RefSeq) epidermal growth factor
  KO
K04357  epidermal growth factor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu04010  MAPK signaling pathway
mmu04012  ErbB signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04066  HIF-1 signaling pathway
mmu04068  FoxO signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04540  Gap junction
mmu04630  JAK-STAT signaling pathway
mmu04810  Regulation of actin cytoskeleton
mmu05160  Hepatitis C
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05210  Colorectal cancer
mmu05212  Pancreatic cancer
mmu05213  Endometrial cancer
mmu05214  Glioma
mmu05215  Prostate cancer
mmu05218  Melanoma
mmu05219  Bladder cancer
mmu05223  Non-small cell lung cancer
mmu05224  Breast cancer
mmu05226  Gastric cancer
mmu05231  Choline metabolism in cancer
mmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    13645 (Egf)
   04012 ErbB signaling pathway
    13645 (Egf)
   04014 Ras signaling pathway
    13645 (Egf)
   04015 Rap1 signaling pathway
    13645 (Egf)
   04630 JAK-STAT signaling pathway
    13645 (Egf)
   04066 HIF-1 signaling pathway
    13645 (Egf)
   04068 FoxO signaling pathway
    13645 (Egf)
   04020 Calcium signaling pathway
    13645 (Egf)
   04072 Phospholipase D signaling pathway
    13645 (Egf)
   04151 PI3K-Akt signaling pathway
    13645 (Egf)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    13645 (Egf)
   04540 Gap junction
    13645 (Egf)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    13645 (Egf)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    13645 (Egf)
   05231 Choline metabolism in cancer
    13645 (Egf)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    13645 (Egf)
  09162 Cancer: specific types
   05210 Colorectal cancer
    13645 (Egf)
   05212 Pancreatic cancer
    13645 (Egf)
   05226 Gastric cancer
    13645 (Egf)
   05214 Glioma
    13645 (Egf)
   05218 Melanoma
    13645 (Egf)
   05219 Bladder cancer
    13645 (Egf)
   05215 Prostate cancer
    13645 (Egf)
   05213 Endometrial cancer
    13645 (Egf)
   05224 Breast cancer
    13645 (Egf)
   05223 Non-small cell lung cancer
    13645 (Egf)
  09172 Infectious disease: viral
   05160 Hepatitis C
    13645 (Egf)
   05165 Human papillomavirus infection
    13645 (Egf)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    13645 (Egf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    13645 (Egf)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   13645 (Egf)
SSDB
Motif
Pfam: Ldl_recept_b FXa_inhibition EGF_CA cEGF EGF EGF_3 DUF5050 SGL Plasmod_Pvs28 EGF_MSP1_1 hEGF Tr-sialidase_C
Other DBs
NCBI-GeneID: 13645
NCBI-ProteinID: NP_034243
MGI: 95290
Ensembl: ENSMUSG00000028017
Vega: OTTMUSG00000054128
UniProt: P01132 Q3UWD7
Structure
PDB: 

Position
3 G3; 3 58.5 cM
AA seq 1217 aa
MPWGRRPTWLLLAFLLVFLKISILSVTAWQTGNCQPGPLERSERSGTCAGPAPFLVFSQG
KSISRIDPDGTNHQQLVVDAGISADMDIHYKKERLYWVDVERQVLLRVFLNGTGLEKVCN
VERKVSGLAIDWIDDEVLWVDQQNGVITVTDMTGKNSRVLLSSLKHPSNIAVDPIERLMF
WSSEVTGSLHRAHLKGVDVKTLLETGGISVLTLDVLDKRLFWVQDSGEGSHAYIHSCDYE
GGSVRLIRHQARHSLSSMAFFGDRIFYSVLKSKAIWIANKHTGKDTVRINLHPSFVTPGK
LMVVHPRAQPRTEDAAKDPDPELLKQRGRPCRFGLCERDPKSHSSACAEGYTLSRDRKYC
EDVNECATQNHGCTLGCENTPGSYHCTCPTGFVLLPDGKQCHELVSCPGNVSKCSHGCVL
TSDGPRCICPAGSVLGRDGKTCTGCSSPDNGGCSQICLPLRPGSWECDCFPGYDLQSDRK
SCAASGPQPLLLFANSQDIRHMHFDGTDYKVLLSRQMGMVFALDYDPVESKIYFAQTALK
WIERANMDGSQRERLITEGVDTLEGLALDWIGRRIYWTDSGKSVVGGSDLSGKHHRIIIQ
ERISRPRGIAVHPRARRLFWTDVGMSPRIESASLQGSDRVLIASSNLLEPSGITIDYLTD
TLYWCDTKRSVIEMANLDGSKRRRLIQNDVGHPFSLAVFEDHLWVSDWAIPSVIRVNKRT
GQNRVRLQGSMLKPSSLVVVHPLAKPGADPCLYRNGGCEHICQESLGTARCLCREGFVKA
WDGKMCLPQDYPILSGENADLSKEVTSLSNSTQAEVPDDDGTESSTLVAEIMVSGMNYED
DCGPGGCGSHARCVSDGETAECQCLKGFARDGNLCSDIDECVLARSDCPSTSSRCINTEG
GYVCRCSEGYEGDGISCFDIDECQRGAHNCGENAACTNTEGGYNCTCAGRPSSPGLSCPD
STAPSLLGEDGHHLDRNSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQT
RDLRWWELRHAGYGQKHDIMVVAVCMVALVLLLVLGMWGTYYYRTRKQLSNPPKNPCDEP
SGSVSSSGPNSSSGAAVASCPQPWFVVLEKHQDPKNGSLPADGTNGAVVDAGLSPSLQLG
SVHLTSWRQKPHIDGMGTGQSCWIPPSSDRGPQEIEGNSHLPSYRPVGPEKLHSLQSANG
SCHERAPDLPRQTEPVQ
NT seq 3654 nt   +upstreamnt  +downstreamnt
atgccctggggccgaaggccaacctggctgttgctcgccttcctgctggtgtttttaaag
attagcatactcagcgtcacagcatggcagaccgggaactgtcagccaggtcctctcgag
agaagcgagagaagcgggacttgtgccggtcctgcccccttcctagttttctcacaagga
aagagcatctctcggattgacccagatggaacaaatcaccagcaattggtggtggatgct
ggcatctcagcagacatggatattcattataaaaaagagagactctattgggtggatgta
gaaagacaagttttgctaagagttttccttaacgggacaggactagagaaagtgtgcaat
gtagagaggaaggtgtctgggctggccatagactggatagatgatgaagttctctgggta
gaccaacagaacggagtcatcaccgtaacagatatgacagggaaaaattcccgagttctt
ctaagttccttaaaacatccgtcaaatatagcagtggatccaatagagaggttgatgttt
tggtcttcagaggtgaccggcagccttcacagagcacacctcaaaggtgttgatgtaaaa
acactgctggagacagggggaatatcggtgctgactctggatgtcctggacaaacggctc
ttctgggttcaggacagtggcgaaggaagccacgcttacattcattcctgtgattatgag
ggtggctccgtccgtcttatcaggcatcaagcacggcacagtttgtcttcaatggccttt
tttggtgatcggatcttctactcagtgttgaaaagcaaggcgatttggatagccaacaaa
cacacggggaaggacacggtcaggattaacctccatccatcctttgtgacacctggaaaa
ctgatggtagtacaccctcgtgcacagcccaggacagaggacgctgctaaggatcctgac
cccgaacttctcaaacagaggggaagaccatgccgcttcggtctctgtgagcgagacccc
aagtcccactcgagcgcatgcgctgagggctacacgttaagccgagaccggaagtactgc
gaagatgtcaatgaatgtgccactcagaatcacggctgtactcttgggtgtgaaaacacc
cctggatcctatcactgcacatgccccacaggatttgttctgcttcctgatgggaaacaa
tgtcacgaacttgtttcctgcccaggcaacgtatcaaagtgcagtcatggctgtgtcctg
acatcagatggtccccggtgcatctgtcctgcaggttcagtgcttgggagagatgggaag
acttgcactggttgttcatcgcctgacaatggtggatgcagccagatctgtcttcctctc
aggccaggatcctgggaatgtgattgctttcctgggtatgacctacagtcagaccgaaag
agctgtgcagcttcaggaccacagccacttttactgtttgcaaattcccaggacatccga
cacatgcattttgatggaacagactacaaagttctgctcagccggcagatgggaatggtt
tttgccttggattatgaccctgtggaaagcaagatatattttgcacagacagccctgaag
tggatagagagggctaatatggatgggtcccagcgagaaagactgatcacagaaggagta
gatacgcttgaaggtcttgccctggactggattggccggagaatctactggacagacagt
gggaagtctgttgttggagggagcgatctgagcgggaagcatcatcgaataatcatccag
gagagaatctcgaggccgcgaggaatagctgtgcatccaagggccaggagactgttctgg
acggacgtagggatgtctccacggattgaaagcgcttcccttcaaggttccgaccgggtg
ctgatagccagctccaatctactggaacccagtggaatcacgattgactacttaacagac
actttgtactggtgtgacaccaagaggtctgtgattgaaatggccaatctggatggctcc
aaacgccgaagacttatccagaacgacgtaggtcaccccttctctctagccgtgtttgag
gatcacctgtgggtctcggattgggctatcccatcggtaataagggtgaacaagaggact
ggccaaaacagggtacgtcttcaaggcagcatgctgaagccctcgtcactggttgtggtc
catccattggcaaaaccaggtgcagatccctgcttatacaggaatggaggctgtgaacac
atctgccaagagagcctgggcacagctcggtgtttgtgtcgtgaaggttttgtgaaggcc
tgggatgggaaaatgtgtctccctcaggattatccaatcctgtcaggtgaaaatgctgat
cttagtaaagaggtgacatcactgagcaactccactcaggctgaagtaccagacgatgat
gggacagaatcttccacactagtggctgaaatcatggtgtcaggcatgaactatgaagat
gactgtggtcccggggggtgtggaagccatgctcgatgcgtttcagacggagagactgct
gagtgtcagtgtctgaaagggtttgccagggatggaaacctgtgttctgatatagatgag
tgtgtgctggctagatcggactgccccagcacctcgtccaggtgcatcaacactgaaggt
ggctacgtctgcagatgctcagaaggctacgaaggagacgggatctcctgtttcgatatt
gacgagtgccagcggggggcgcacaactgcggtgagaatgccgcctgcaccaacacggag
ggaggctacaactgcacctgcgcaggccgcccatcctcgcccggactgagttgccctgac
tctaccgcaccctctctccttggggaagatggccaccatttggaccgaaatagttatcca
ggatgcccatcctcatatgatggatactgcctcaatggtggcgtgtgcatgcatattgaa
tcactggacagctacacatgcaactgtgttattggctattctggggatcgatgccagact
cgagacctacgatggtgggaactgcgtcatgctggctacgggcagaagcatgacatcatg
gtggtggctgtctgcatggtggcactggtcctgctgctcgtcttggggatgtgggggact
tactactacaggactcggaagcagctatcaaaccccccaaagaacccttgtgatgagcca
agcggaagtgtgagcagcagcggacccaacagcagcagcggggcagctgtggcttcttgt
ccccaaccttggtttgtggtcctagagaaacaccaagaccccaagaatgggagtctgcct
gcggatggtacgaatggtgcagtagtagatgctggcctgtctccctccctgcagctcggg
tcagtgcatctgacttcatggagacagaagccccacatagatggaatgggcacagggcaa
agctgctggattccaccatcaagtgacagaggaccccaggaaatagagggaaactcccac
ctaccctcctacagacctgtggggccggagaagctgcattctctccagtcagctaatgga
tcgtgtcacgaaagggctccagacctgccacggcagacagagccagttcagtag

KEGG   Mus musculus (mouse): 16000
Entry
16000             CDS       T01002                                 

Gene name
Igf1, C730016P09Rik, Igf, Igf-, Igf-1, Igf-I
Definition
(RefSeq) insulin-like growth factor 1
  KO
K05459  insulin-like growth factor 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu01522  Endocrine resistance
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04066  HIF-1 signaling pathway
mmu04068  FoxO signaling pathway
mmu04114  Oocyte meiosis
mmu04115  p53 signaling pathway
mmu04150  mTOR signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04152  AMPK signaling pathway
mmu04211  Longevity regulating pathway
mmu04213  Longevity regulating pathway - multiple species
mmu04510  Focal adhesion
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu04730  Long-term depression
mmu04750  Inflammatory mediator regulation of TRP channels
mmu04913  Ovarian steroidogenesis
mmu04914  Progesterone-mediated oocyte maturation
mmu04935  Growth hormone synthesis, secretion and action
mmu04960  Aldosterone-regulated sodium reabsorption
mmu05200  Pathways in cancer
mmu05202  Transcriptional misregulation in cancer
mmu05205  Proteoglycans in cancer
mmu05214  Glioma
mmu05215  Prostate cancer
mmu05218  Melanoma
mmu05224  Breast cancer
mmu05410  Hypertrophic cardiomyopathy
mmu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    16000 (Igf1)
   04014 Ras signaling pathway
    16000 (Igf1)
   04015 Rap1 signaling pathway
    16000 (Igf1)
   04066 HIF-1 signaling pathway
    16000 (Igf1)
   04068 FoxO signaling pathway
    16000 (Igf1)
   04151 PI3K-Akt signaling pathway
    16000 (Igf1)
   04152 AMPK signaling pathway
    16000 (Igf1)
   04150 mTOR signaling pathway
    16000 (Igf1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    16000 (Igf1)
   04115 p53 signaling pathway
    16000 (Igf1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    16000 (Igf1)
   04550 Signaling pathways regulating pluripotency of stem cells
    16000 (Igf1)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    16000 (Igf1)
   04914 Progesterone-mediated oocyte maturation
    16000 (Igf1)
   04935 Growth hormone synthesis, secretion and action
    16000 (Igf1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    16000 (Igf1)
  09156 Nervous system
   04730 Long-term depression
    16000 (Igf1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    16000 (Igf1)
  09149 Aging
   04211 Longevity regulating pathway
    16000 (Igf1)
   04213 Longevity regulating pathway - multiple species
    16000 (Igf1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16000 (Igf1)
   05202 Transcriptional misregulation in cancer
    16000 (Igf1)
   05205 Proteoglycans in cancer
    16000 (Igf1)
  09162 Cancer: specific types
   05214 Glioma
    16000 (Igf1)
   05218 Melanoma
    16000 (Igf1)
   05215 Prostate cancer
    16000 (Igf1)
   05224 Breast cancer
    16000 (Igf1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    16000 (Igf1)
   05414 Dilated cardiomyopathy
    16000 (Igf1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    16000 (Igf1)
   01522 Endocrine resistance
    16000 (Igf1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    16000 (Igf1)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   16000 (Igf1)
SSDB
Motif
Pfam: Insulin
Other DBs
NCBI-GeneID: 16000
NCBI-ProteinID: NP_001104745
MGI: 96432
Ensembl: ENSMUSG00000020053
Vega: OTTMUSG00000031391
UniProt: P05017 Q4VJC0
Position
10 C1; 10 43.7 cM
AA seq 153 aa
MGKISSLPTQLFKICLCDFLKIKIHIMSSSHLFYLALCLLTFTSSTTAGPETLCGAELVD
ALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKAARS
IRAQRHTDMPKTQKEVHLKNTSRGSAGNKTYRM
NT seq 462 nt   +upstreamnt  +downstreamnt
atggggaaaatcagcagccttccaactcaattatttaagatctgcctctgtgacttcttg
aagataaagatacacatcatgtcgtcttcacacctcttctacctggcgctctgcttgctc
accttcaccagctccaccacagctggaccagagaccctttgcggggctgagctggtggat
gctcttcagttcgtgtgtggaccgaggggcttttacttcaacaagcccacaggctatggc
tccagcattcggagggcacctcagacaggcattgtggatgagtgttgcttccggagctgt
gatctgaggagactggagatgtactgtgccccactgaagcctacaaaagcagcccgctct
atccgtgcccagcgccacactgacatgcccaagactcagaaggaagtacatttgaagaac
acaagtagaggaagtgcaggaaacaagacctacagaatgtag

KEGG   Mus musculus (mouse): 16333
Entry
16333             CDS       T01002                                 

Gene name
Ins1, Ins-1, Ins2-rs1
Definition
(RefSeq) insulin I
  KO
K04526  insulin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04066  HIF-1 signaling pathway
mmu04068  FoxO signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04114  Oocyte meiosis
mmu04140  Autophagy - animal
mmu04150  mTOR signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04152  AMPK signaling pathway
mmu04211  Longevity regulating pathway
mmu04213  Longevity regulating pathway - multiple species
mmu04810  Regulation of actin cytoskeleton
mmu04910  Insulin signaling pathway
mmu04911  Insulin secretion
mmu04913  Ovarian steroidogenesis
mmu04914  Progesterone-mediated oocyte maturation
mmu04917  Prolactin signaling pathway
mmu04923  Regulation of lipolysis in adipocytes
mmu04930  Type II diabetes mellitus
mmu04931  Insulin resistance
mmu04932  Non-alcoholic fatty liver disease
mmu04940  Type I diabetes mellitus
mmu04950  Maturity onset diabetes of the young
mmu04960  Aldosterone-regulated sodium reabsorption
mmu05010  Alzheimer disease
mmu05215  Prostate cancer
mmu05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    16333 (Ins1)
   04014 Ras signaling pathway
    16333 (Ins1)
   04015 Rap1 signaling pathway
    16333 (Ins1)
   04066 HIF-1 signaling pathway
    16333 (Ins1)
   04068 FoxO signaling pathway
    16333 (Ins1)
   04072 Phospholipase D signaling pathway
    16333 (Ins1)
   04022 cGMP-PKG signaling pathway
    16333 (Ins1)
   04151 PI3K-Akt signaling pathway
    16333 (Ins1)
   04152 AMPK signaling pathway
    16333 (Ins1)
   04150 mTOR signaling pathway
    16333 (Ins1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    16333 (Ins1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    16333 (Ins1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    16333 (Ins1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    16333 (Ins1)
   04910 Insulin signaling pathway
    16333 (Ins1)
   04923 Regulation of lipolysis in adipocytes
    16333 (Ins1)
   04913 Ovarian steroidogenesis
    16333 (Ins1)
   04914 Progesterone-mediated oocyte maturation
    16333 (Ins1)
   04917 Prolactin signaling pathway
    16333 (Ins1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    16333 (Ins1)
  09149 Aging
   04211 Longevity regulating pathway
    16333 (Ins1)
   04213 Longevity regulating pathway - multiple species
    16333 (Ins1)
 09160 Human Diseases
  09162 Cancer: specific types
   05215 Prostate cancer
    16333 (Ins1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    16333 (Ins1)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    16333 (Ins1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    16333 (Ins1)
   04940 Type I diabetes mellitus
    16333 (Ins1)
   04950 Maturity onset diabetes of the young
    16333 (Ins1)
   04932 Non-alcoholic fatty liver disease
    16333 (Ins1)
   04931 Insulin resistance
    16333 (Ins1)
SSDB
Motif
Pfam: Insulin Ins_beta
Other DBs
NCBI-GeneID: 16333
NCBI-ProteinID: NP_032412
MGI: 96572
Ensembl: ENSMUSG00000035804
UniProt: P01325
Position
19 D2; 19 46.76 cM
AA seq 108 aa
MALLVHFLPLLALLALWEPKPTQAFVKQHLCGPHLVEALYLVCGERGFFYTPKSRREVED
PQVEQLELGGSPGDLQTLALEVARQKRGIVDQCCTSICSLYQLENYCN
NT seq 327 nt   +upstreamnt  +downstreamnt
atggccctgttggtgcacttcctacccctgctggccctgcttgccctctgggagcccaaa
cccacccaggcttttgtcaaacagcatctttgtggtccccacctggtagaggctctctac
ctggtgtgtggggagcgtggcttcttctacacacccaagtcccgccgtgaagtggaggac
ccacaagtggaacaactggagctgggaggaagccccggggaccttcagaccttggcgttg
gaggtggcccggcagaagcgtggcattgtggatcagtgctgcaccagcatctgctccctc
taccagctggagaactactgcaactaa

KEGG   Mus musculus (mouse): 16334
Entry
16334             CDS       T01002                                 

Gene name
Ins2, AA986540, In, Ins-2, InsII, Mod, Mody, Mody4
Definition
(RefSeq) insulin II
  KO
K04526  insulin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04066  HIF-1 signaling pathway
mmu04068  FoxO signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04114  Oocyte meiosis
mmu04140  Autophagy - animal
mmu04150  mTOR signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04152  AMPK signaling pathway
mmu04211  Longevity regulating pathway
mmu04213  Longevity regulating pathway - multiple species
mmu04810  Regulation of actin cytoskeleton
mmu04910  Insulin signaling pathway
mmu04911  Insulin secretion
mmu04913  Ovarian steroidogenesis
mmu04914  Progesterone-mediated oocyte maturation
mmu04917  Prolactin signaling pathway
mmu04923  Regulation of lipolysis in adipocytes
mmu04930  Type II diabetes mellitus
mmu04931  Insulin resistance
mmu04932  Non-alcoholic fatty liver disease
mmu04940  Type I diabetes mellitus
mmu04950  Maturity onset diabetes of the young
mmu04960  Aldosterone-regulated sodium reabsorption
mmu05010  Alzheimer disease
mmu05215  Prostate cancer
mmu05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    16334 (Ins2)
   04014 Ras signaling pathway
    16334 (Ins2)
   04015 Rap1 signaling pathway
    16334 (Ins2)
   04066 HIF-1 signaling pathway
    16334 (Ins2)
   04068 FoxO signaling pathway
    16334 (Ins2)
   04072 Phospholipase D signaling pathway
    16334 (Ins2)
   04022 cGMP-PKG signaling pathway
    16334 (Ins2)
   04151 PI3K-Akt signaling pathway
    16334 (Ins2)
   04152 AMPK signaling pathway
    16334 (Ins2)
   04150 mTOR signaling pathway
    16334 (Ins2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    16334 (Ins2)
  09143 Cell growth and death
   04114 Oocyte meiosis
    16334 (Ins2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    16334 (Ins2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    16334 (Ins2)
   04910 Insulin signaling pathway
    16334 (Ins2)
   04923 Regulation of lipolysis in adipocytes
    16334 (Ins2)
   04913 Ovarian steroidogenesis
    16334 (Ins2)
   04914 Progesterone-mediated oocyte maturation
    16334 (Ins2)
   04917 Prolactin signaling pathway
    16334 (Ins2)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    16334 (Ins2)
  09149 Aging
   04211 Longevity regulating pathway
    16334 (Ins2)
   04213 Longevity regulating pathway - multiple species
    16334 (Ins2)
 09160 Human Diseases
  09162 Cancer: specific types
   05215 Prostate cancer
    16334 (Ins2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    16334 (Ins2)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    16334 (Ins2)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    16334 (Ins2)
   04940 Type I diabetes mellitus
    16334 (Ins2)
   04950 Maturity onset diabetes of the young
    16334 (Ins2)
   04932 Non-alcoholic fatty liver disease
    16334 (Ins2)
   04931 Insulin resistance
    16334 (Ins2)
SSDB
Motif
Pfam: Insulin Ins_beta
Other DBs
NCBI-GeneID: 16334
NCBI-ProteinID: NP_001172012
MGI: 96573
Ensembl: ENSMUSG00000000215
Vega: OTTMUSG00000018794
UniProt: P01326 Q5EEX1
Position
7 F5; 7 88.0 cM
AA seq 110 aa
MALWMRFLPLLALLFLWESHPTQAFVKQHLCGSHLVEALYLVCGERGFFYTPMSRREVED
PQVAQLELGGGPGAGDLQTLALEVAQQKRGIVDQCCTSICSLYQLENYCN
NT seq 333 nt   +upstreamnt  +downstreamnt
atggccctgtggatgcgcttcctgcccctgctggccctgctcttcctctgggagtcccac
cccacccaggcttttgtcaagcagcacctttgtggttcccacctggtggaggctctctac
ctggtgtgtggggagcgtggcttcttctacacacccatgtcccgccgtgaagtggaggac
ccacaagtggcacaactggagctgggtggaggcccgggagcaggtgaccttcagaccttg
gcactggaggtggcccagcagaagcgtggcattgtagatcagtgctgcaccagcatctgc
tccctctaccagctggagaactactgcaactag

KEGG   Mus musculus (mouse): 18590
Entry
18590             CDS       T01002                                 

Gene name
Pdgfa, PDGF-1
Definition
(RefSeq) platelet derived growth factor, alpha
  KO
K04359  platelet-derived growth factor subunit A
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04540  Gap junction
mmu04630  JAK-STAT signaling pathway
mmu04810  Regulation of actin cytoskeleton
mmu05200  Pathways in cancer
mmu05202  Transcriptional misregulation in cancer
mmu05206  MicroRNAs in cancer
mmu05214  Glioma
mmu05215  Prostate cancer
mmu05218  Melanoma
mmu05231  Choline metabolism in cancer
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    18590 (Pdgfa)
   04014 Ras signaling pathway
    18590 (Pdgfa)
   04015 Rap1 signaling pathway
    18590 (Pdgfa)
   04630 JAK-STAT signaling pathway
    18590 (Pdgfa)
   04020 Calcium signaling pathway
    18590 (Pdgfa)
   04072 Phospholipase D signaling pathway
    18590 (Pdgfa)
   04151 PI3K-Akt signaling pathway
    18590 (Pdgfa)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    18590 (Pdgfa)
   04540 Gap junction
    18590 (Pdgfa)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    18590 (Pdgfa)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    18590 (Pdgfa)
   05202 Transcriptional misregulation in cancer
    18590 (Pdgfa)
   05206 MicroRNAs in cancer
    18590 (Pdgfa)
   05231 Choline metabolism in cancer
    18590 (Pdgfa)
  09162 Cancer: specific types
   05214 Glioma
    18590 (Pdgfa)
   05218 Melanoma
    18590 (Pdgfa)
   05215 Prostate cancer
    18590 (Pdgfa)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    18590 (Pdgfa)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    18590 (Pdgfa)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    18590 (Pdgfa)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    18590 (Pdgfa)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   18590 (Pdgfa)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   18590 (Pdgfa)
SSDB
Motif
Pfam: PDGF_N PDGF
Other DBs
NCBI-GeneID: 18590
NCBI-ProteinID: NP_032834
MGI: 97527
Ensembl: ENSMUSG00000025856
Vega: OTTMUSG00000025151
UniProt: P20033 Q99L56
Position
5 G2; 5 77.65 cM
AA seq 196 aa
MRTWACLLLLGCGYLAHALAEEAEIPRELIERLARSQIHSIRDLQRLLEIDSVGAEDALE
TSLRAHGSHAINHVPEKRPVPIRRKRSIEEAIPAVCKTRTVIYEIPRSQVDPTSANFLIW
PPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACA
TSNLNPDHREEETDVR
NT seq 591 nt   +upstreamnt  +downstreamnt
atgaggacctgggcttgcctgctgctcctcggctgcggatacctcgcccatgccctggcc
gaggaagccgagataccccgggagttgatcgagcggctggctcgaagtcagatccacagc
atccgggacctccagcgactcttggagatagactccgtaggggctgaggatgccttggag
acaagtctgagagcccatgggtcccatgccattaaccatgtgcccgagaagcggcctgtg
cccattcgcaggaagagaagtattgaggaagccattcctgcagtttgcaagaccaggacg
gtcatttacgagatacctcggagccaggtggaccccacatcggccaacttcctgatctgg
cccccatgtgtggaggtgaagcgctgcactggctgttgtaacaccagcagcgtcaagtgc
cagccttcacgggtccaccaccgcagtgtcaaggtggccaaagtggagtatgtcaggaag
aagccaaaattgaaagaggtccaggtgaggttagaggaacacctggagtgtgcatgtgcg
acctccaacctgaacccagaccatcgggaggaggagacagatgtgaggtga

KEGG   Mus musculus (mouse): 18591
Entry
18591             CDS       T01002                                 

Gene name
Pdgfb, PDGF-, PDGF-2, PDGF-B, Sis, c-sis
Definition
(RefSeq) platelet derived growth factor, B polypeptide
  KO
K17386  platelet-derived growth factor subunit B
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04540  Gap junction
mmu04630  JAK-STAT signaling pathway
mmu04810  Regulation of actin cytoskeleton
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05200  Pathways in cancer
mmu05206  MicroRNAs in cancer
mmu05211  Renal cell carcinoma
mmu05214  Glioma
mmu05215  Prostate cancer
mmu05218  Melanoma
mmu05231  Choline metabolism in cancer
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    18591 (Pdgfb)
   04014 Ras signaling pathway
    18591 (Pdgfb)
   04015 Rap1 signaling pathway
    18591 (Pdgfb)
   04630 JAK-STAT signaling pathway
    18591 (Pdgfb)
   04020 Calcium signaling pathway
    18591 (Pdgfb)
   04072 Phospholipase D signaling pathway
    18591 (Pdgfb)
   04151 PI3K-Akt signaling pathway
    18591 (Pdgfb)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    18591 (Pdgfb)
   04540 Gap junction
    18591 (Pdgfb)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    18591 (Pdgfb)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    18591 (Pdgfb)
   05206 MicroRNAs in cancer
    18591 (Pdgfb)
   05231 Choline metabolism in cancer
    18591 (Pdgfb)
  09162 Cancer: specific types
   05214 Glioma
    18591 (Pdgfb)
   05218 Melanoma
    18591 (Pdgfb)
   05211 Renal cell carcinoma
    18591 (Pdgfb)
   05215 Prostate cancer
    18591 (Pdgfb)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    18591 (Pdgfb)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    18591 (Pdgfb)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    18591 (Pdgfb)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    18591 (Pdgfb)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    18591 (Pdgfb)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   18591 (Pdgfb)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   18591 (Pdgfb)
SSDB
Motif
Pfam: PDGF PDGF_N
Other DBs
NCBI-GeneID: 18591
NCBI-ProteinID: NP_035187
MGI: 97528
Ensembl: ENSMUSG00000000489
UniProt: P31240 A0A0R4IZW4
Position
15 E1; 15 37.85 cM
AA seq 241 aa
MNRCWALFLPLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHRDSVDEDGAEL
DLNMTRAHSGVELESSSRGRRSLGSLAAAEPAVIAECKTRTEVFQISRNLIDRTNANFLV
WPPCVEVQRCSGCCNNRNVQCRASQVQMRPVQVRKIEIVRKKPIFKKATVTLEDHLACKC
ETVVTPRPVTRSPGTSREQRAKTPQARVTIRTVRIRRPPKGKHRKFKHTHDKAALKETLG
A
NT seq 726 nt   +upstreamnt  +downstreamnt
atgaatcgctgctgggcgctcttccttcctctctgctgctacctgcgtctggtcagcgcc
gagggggatcccattcctgaggaactgtatgaaatgctgagcgaccactccatccgctcc
tttgatgatcttcagcgcctgctgcacagagactccgtagatgaagatggggctgagctg
gacttgaacatgacccgagcacactccggagtcgagttggaaagctcatctcgagggagg
aggagcctagggtccctggcagcagcagagcctgctgtaatcgccgagtgcaagacgcgc
acagaggtgttccagatctctcggaacctcatcgatcgcaccaacgccaacttcctggtg
tggccgccctgtgtggaggtgcagcgctgctccggctgctgcaataaccgcaatgtgcaa
tgccgggcctcgcaggtgcagatgcggccggtccaggtgagaaagattgagattgtgcga
aagaagcccatcttcaagaaggccacagtgaccttggaggaccacctcgcctgcaagtgt
gagacagtagtgacccctcggcctgtgactagaagtcctgggacatccagggagcagcga
gccaagacgcctcaagctcgggtgaccattcggacggtgagaatccgccggccccccaaa
ggcaagcaccgaaagtttaagcacacccatgacaaggcggccctgaaggagaccctcgga
gcctag

KEGG   Mus musculus (mouse): 21802
Entry
21802             CDS       T01002                                 

Gene name
Tgfa, wa-1, wa1
Definition
(RefSeq) transforming growth factor alpha
  KO
K08774  transforming growth factor, alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu04010  MAPK signaling pathway
mmu04012  ErbB signaling pathway
mmu04014  Ras signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04915  Estrogen signaling pathway
mmu05200  Pathways in cancer
mmu05210  Colorectal cancer
mmu05211  Renal cell carcinoma
mmu05212  Pancreatic cancer
mmu05214  Glioma
mmu05215  Prostate cancer
mmu05223  Non-small cell lung cancer
mmu05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    21802 (Tgfa)
   04012 ErbB signaling pathway
    21802 (Tgfa)
   04014 Ras signaling pathway
    21802 (Tgfa)
   04151 PI3K-Akt signaling pathway
    21802 (Tgfa)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    21802 (Tgfa)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    21802 (Tgfa)
  09162 Cancer: specific types
   05210 Colorectal cancer
    21802 (Tgfa)
   05212 Pancreatic cancer
    21802 (Tgfa)
   05225 Hepatocellular carcinoma
    21802 (Tgfa)
   05214 Glioma
    21802 (Tgfa)
   05211 Renal cell carcinoma
    21802 (Tgfa)
   05215 Prostate cancer
    21802 (Tgfa)
   05223 Non-small cell lung cancer
    21802 (Tgfa)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    21802 (Tgfa)
SSDB
Motif
Pfam: EGF TMEM154
Other DBs
NCBI-GeneID: 21802
NCBI-ProteinID: NP_112476
MGI: 98724
Ensembl: ENSMUSG00000029999
Vega: OTTMUSG00000049992
UniProt: P48030 Q545E4
Position
6 D1; 6 37.62 cM
AA seq 159 aa
MVPATGQLALLALGILLAVCQALENSTSPLSDSPVAAAVVSHFNKCPDSHTQYCFHGTCR
FLVQEEKPACVCHSGYVGVRCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVLI
HCCQLRKHCEWCRALVCRHEKPSALLKGRTACCHSETVV
NT seq 480 nt   +upstreamnt  +downstreamnt
atggtccccgcgaccggacagctcgctctgctagcgctgggtatcctgttagctgtgtgc
caggctctggagaacagcacatcccccctgagtgactcacccgtggcggctgcagtggtg
tctcacttcaacaagtgcccagattcccacactcagtactgcttccatggaacctgccgg
tttttggtgcaggaagagaagccagcatgtgtctgccactctgggtacgtgggtgttcgc
tgtgagcatgcagacctcctggctgtggtggctgccagccagaagaagcaagccatcact
gccctggtggtggtctccattgtggccctggctgtcctcattatcacctgtgtgctgatc
cactgctgtcagctccgcaaacactgtgagtggtgccgtgccctcgtctgcagacatgag
aagcccagcgccctcctgaagggaaggactgcttgctgccactctgagacagtggtctga

KEGG   Mus musculus (mouse): 54635
Entry
54635             CDS       T01002                                 

Gene name
Pdgfc, 1110064L01Rik, AI647969, PDGF-, PDGF-C, SCDGF, VEGF-E
Definition
(RefSeq) platelet-derived growth factor, C polypeptide
  KO
K05450  platelet derived growth factor C/D
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04540  Gap junction
mmu04810  Regulation of actin cytoskeleton
mmu05215  Prostate cancer
mmu05218  Melanoma
mmu05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    54635 (Pdgfc)
   04014 Ras signaling pathway
    54635 (Pdgfc)
   04015 Rap1 signaling pathway
    54635 (Pdgfc)
   04020 Calcium signaling pathway
    54635 (Pdgfc)
   04072 Phospholipase D signaling pathway
    54635 (Pdgfc)
   04151 PI3K-Akt signaling pathway
    54635 (Pdgfc)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    54635 (Pdgfc)
   04540 Gap junction
    54635 (Pdgfc)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    54635 (Pdgfc)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    54635 (Pdgfc)
  09162 Cancer: specific types
   05218 Melanoma
    54635 (Pdgfc)
   05215 Prostate cancer
    54635 (Pdgfc)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    54635 (Pdgfc)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    54635 (Pdgfc)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   54635 (Pdgfc)
SSDB
Motif
Pfam: CUB PDGF
Other DBs
NCBI-GeneID: 54635
NCBI-ProteinID: NP_064355
MGI: 1859631
Ensembl: ENSMUSG00000028019
Vega: OTTMUSG00000028878
UniProt: Q8CI19
Position
3; 3 E3
AA seq 345 aa
MLLLGLLLLTSALAGQRTGTRAESNLSSKLQLSSDKEQNGVQDPRHERVVTISGNGSIHS
PKFPHTYPRNMVLVWRLVAVDENVRIQLTFDERFGLEDPEDDICKYDFVEVEEPSDGSVL
GRWCGSGTVPGKQTSKGNHIRIRFVSDEYFPSEPGFCIHYSIIMPQVTETTSPSVLPPSS
LSLDLLNNAVTAFSTLEELIRYLEPDRWQVDLDSLYKPTWQLLGKAFLYGKKSKVVNLNL
LKEEVKLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPRK
VTKKYHEVLQLRPKTGVKGLHKSLTDVALEHHEECDCVCRGNAGG
NT seq 1038 nt   +upstreamnt  +downstreamnt
atgctcctcctcggcctcctcctgctgacatctgccctggccggccaaagaacggggact
cgggctgagtccaacctgagcagcaagttgcagctctccagcgacaaggaacagaacgga
gtgcaagatccccggcatgagagagttgtcactatatctggtaatgggagcatccacagc
ccgaagtttcctcatacatacccaagaaatatggtgctggtgtggagattagttgcagta
gatgaaaatgtgcggatccagctgacatttgatgagagatttgggctggaagatccagaa
gacgatatatgcaagtatgattttgtagaagttgaggagcccagtgatggaagtgtttta
ggacgctggtgtggttctgggactgtgccaggaaagcagacttctaaaggaaatcatatc
aggataagatttgtatctgatgagtattttccatctgaacccggattctgcatccactac
agtattatcatgccacaagtcacagaaaccacgagtccttcggtgttgcccccttcatct
ttgtcattggacctgctcaacaatgctgtgactgccttcagtaccttggaagagctgatt
cggtacctagagccagatcgatggcaggtggacttggacagcctctacaagccaacatgg
cagcttttgggcaaggctttcctgtatgggaaaaaaagcaaagtggtgaatctgaatctc
ctcaaggaagaggtaaaactctacagctgcacaccccggaacttctcagtgtccatacgg
gaagagctaaagaggacagataccatattctggccaggttgtctcctggtcaagcgctgt
ggaggaaattgtgcctgttgtctccataattgcaatgaatgtcagtgtgtcccacgtaaa
gttacaaaaaagtaccatgaggtccttcagttgagaccaaaaactggagtcaagggattg
cataagtcactcactgatgtggctctggaacaccacgaggaatgtgactgtgtgtgtaga
ggaaacgcaggagggtaa

KEGG   Mus musculus (mouse): 71785
Entry
71785             CDS       T01002                                 

Gene name
Pdgfd, 1110003I09Rik
Definition
(RefSeq) platelet-derived growth factor, D polypeptide
  KO
K05450  platelet derived growth factor C/D
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04540  Gap junction
mmu04810  Regulation of actin cytoskeleton
mmu05215  Prostate cancer
mmu05218  Melanoma
mmu05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    71785 (Pdgfd)
   04014 Ras signaling pathway
    71785 (Pdgfd)
   04015 Rap1 signaling pathway
    71785 (Pdgfd)
   04020 Calcium signaling pathway
    71785 (Pdgfd)
   04072 Phospholipase D signaling pathway
    71785 (Pdgfd)
   04151 PI3K-Akt signaling pathway
    71785 (Pdgfd)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    71785 (Pdgfd)
   04540 Gap junction
    71785 (Pdgfd)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    71785 (Pdgfd)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    71785 (Pdgfd)
  09162 Cancer: specific types
   05218 Melanoma
    71785 (Pdgfd)
   05215 Prostate cancer
    71785 (Pdgfd)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    71785 (Pdgfd)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    71785 (Pdgfd)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   71785 (Pdgfd)
SSDB
Motif
Pfam: CUB PDGF
Other DBs
NCBI-GeneID: 71785
NCBI-ProteinID: NP_082200
MGI: 1919035
Ensembl: ENSMUSG00000032006
Vega: OTTMUSG00000062234
UniProt: Q925I7
Position
9; 9 A1
AA seq 370 aa
MQRLVLVSILLCANFSCYPDTFATPQRASIKALRNANLRRDESNHLTDLYQREENIQVTS
NGHVQSPRFPNSYPRNLLLTWWLRSQEKTRIQLSFDHQFGLEEAENDICRYDFVEVEEVS
ESSTVVRGRWCGHKEIPPRITSRTNQIKITFKSDDYFVAKPGFKIYYSFVEDFQPEAASE
TNWESVTSSFSGVSYHSPSITDPTLTADALDKTVAEFDTVEDLLKHFNPVSWQDDLENLY
LDTPHYRGRSYHDRKSKVDLDRLNDDVKRYSCTPRNHSVNLREELKLTNAVFFPRCLLVQ
RCGGNCGCGTVNWKSCTCSSGKTVKKYHEVLKFEPGHFKRRGKAKNMALVDIQLDHHERC
DCICSSRPPR
NT seq 1113 nt   +upstreamnt  +downstreamnt
atgcaacggctcgttttagtctccattctcctgtgcgcgaactttagctgctatccggac
acttttgcgactccgcagagagcatccatcaaagctttgcgcaatgccaacctcaggaga
gatgagagcaatcacctcacagacttgtaccagagagaggagaacattcaggtgacaagc
aatggccatgtgcagagtcctcgcttcccgaacagctacccaaggaacctgcttctgaca
tggtggctccgttcccaggagaaaacacggatacaactgtcctttgaccatcaattcgga
ctagaggaagcagaaaatgacatttgtaggtatgactttgtggaagttgaagaagtctca
gagagcagcactgttgtcagaggaagatggtgtggccacaaggagatccctccaaggata
acgtcaagaacaaaccagattaaaatcacatttaagtctgatgactactttgtggcaaaa
cctggattcaagatttattattcatttgtggaagatttccaaccggaagcagcctcagag
accaactgggaatcagtcacaagctctttctctggggtgtcctatcactctccatcaata
acggaccccactctcactgctgatgccctggacaaaactgtcgcagaattcgataccgtg
gaagatctacttaagcacttcaatccagtgtcttggcaagatgatctggagaatttgtat
ctggacacccctcattatagaggcaggtcataccatgatcggaagtccaaagtggacctg
gacaggctcaatgatgatgtcaagcgttacagttgcactcccaggaatcactctgtgaac
ctcagggaggagctgaagctgaccaatgcagtcttcttcccacgatgcctcctcgtgcag
cgctgtggtggcaactgtggttgcggaactgtcaactggaagtcctgcacatgcagctca
gggaagacagtgaagaagtatcatgaggtattgaagtttgagcctggacatttcaagaga
aggggcaaagctaagaatatggctcttgttgatatccagctggatcatcatgagcgatgt
gactgtatctgcagctcaagaccacctcgataa

DBGET integrated database retrieval system