KEGG   Mus musculus (mouse): 13645
Entry
13645             CDS       T01002                                 

Gene name
Egf, AI790464
Definition
(RefSeq) epidermal growth factor
  KO
K04357  epidermal growth factor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu04010  MAPK signaling pathway
mmu04012  ErbB signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04066  HIF-1 signaling pathway
mmu04068  FoxO signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04540  Gap junction
mmu04630  JAK-STAT signaling pathway
mmu04810  Regulation of actin cytoskeleton
mmu05160  Hepatitis C
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05210  Colorectal cancer
mmu05212  Pancreatic cancer
mmu05213  Endometrial cancer
mmu05214  Glioma
mmu05215  Prostate cancer
mmu05218  Melanoma
mmu05219  Bladder cancer
mmu05223  Non-small cell lung cancer
mmu05224  Breast cancer
mmu05226  Gastric cancer
mmu05231  Choline metabolism in cancer
mmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    13645 (Egf)
   04012 ErbB signaling pathway
    13645 (Egf)
   04014 Ras signaling pathway
    13645 (Egf)
   04015 Rap1 signaling pathway
    13645 (Egf)
   04630 JAK-STAT signaling pathway
    13645 (Egf)
   04066 HIF-1 signaling pathway
    13645 (Egf)
   04068 FoxO signaling pathway
    13645 (Egf)
   04020 Calcium signaling pathway
    13645 (Egf)
   04072 Phospholipase D signaling pathway
    13645 (Egf)
   04151 PI3K-Akt signaling pathway
    13645 (Egf)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    13645 (Egf)
   04540 Gap junction
    13645 (Egf)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    13645 (Egf)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    13645 (Egf)
   05231 Choline metabolism in cancer
    13645 (Egf)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    13645 (Egf)
  09162 Cancer: specific types
   05210 Colorectal cancer
    13645 (Egf)
   05212 Pancreatic cancer
    13645 (Egf)
   05226 Gastric cancer
    13645 (Egf)
   05214 Glioma
    13645 (Egf)
   05218 Melanoma
    13645 (Egf)
   05219 Bladder cancer
    13645 (Egf)
   05215 Prostate cancer
    13645 (Egf)
   05213 Endometrial cancer
    13645 (Egf)
   05224 Breast cancer
    13645 (Egf)
   05223 Non-small cell lung cancer
    13645 (Egf)
  09172 Infectious disease: viral
   05160 Hepatitis C
    13645 (Egf)
   05165 Human papillomavirus infection
    13645 (Egf)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    13645 (Egf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    13645 (Egf)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   13645 (Egf)
SSDB
Motif
Pfam: Ldl_recept_b FXa_inhibition EGF_CA cEGF EGF EGF_3 DUF5050 SGL Plasmod_Pvs28 EGF_MSP1_1 hEGF Tr-sialidase_C
Other DBs
NCBI-GeneID: 13645
NCBI-ProteinID: NP_034243
MGI: 95290
Ensembl: ENSMUSG00000028017
Vega: OTTMUSG00000054128
UniProt: P01132 Q3UWD7
Structure
PDB: 

Position
3 G3; 3 58.5 cM
AA seq 1217 aa
MPWGRRPTWLLLAFLLVFLKISILSVTAWQTGNCQPGPLERSERSGTCAGPAPFLVFSQG
KSISRIDPDGTNHQQLVVDAGISADMDIHYKKERLYWVDVERQVLLRVFLNGTGLEKVCN
VERKVSGLAIDWIDDEVLWVDQQNGVITVTDMTGKNSRVLLSSLKHPSNIAVDPIERLMF
WSSEVTGSLHRAHLKGVDVKTLLETGGISVLTLDVLDKRLFWVQDSGEGSHAYIHSCDYE
GGSVRLIRHQARHSLSSMAFFGDRIFYSVLKSKAIWIANKHTGKDTVRINLHPSFVTPGK
LMVVHPRAQPRTEDAAKDPDPELLKQRGRPCRFGLCERDPKSHSSACAEGYTLSRDRKYC
EDVNECATQNHGCTLGCENTPGSYHCTCPTGFVLLPDGKQCHELVSCPGNVSKCSHGCVL
TSDGPRCICPAGSVLGRDGKTCTGCSSPDNGGCSQICLPLRPGSWECDCFPGYDLQSDRK
SCAASGPQPLLLFANSQDIRHMHFDGTDYKVLLSRQMGMVFALDYDPVESKIYFAQTALK
WIERANMDGSQRERLITEGVDTLEGLALDWIGRRIYWTDSGKSVVGGSDLSGKHHRIIIQ
ERISRPRGIAVHPRARRLFWTDVGMSPRIESASLQGSDRVLIASSNLLEPSGITIDYLTD
TLYWCDTKRSVIEMANLDGSKRRRLIQNDVGHPFSLAVFEDHLWVSDWAIPSVIRVNKRT
GQNRVRLQGSMLKPSSLVVVHPLAKPGADPCLYRNGGCEHICQESLGTARCLCREGFVKA
WDGKMCLPQDYPILSGENADLSKEVTSLSNSTQAEVPDDDGTESSTLVAEIMVSGMNYED
DCGPGGCGSHARCVSDGETAECQCLKGFARDGNLCSDIDECVLARSDCPSTSSRCINTEG
GYVCRCSEGYEGDGISCFDIDECQRGAHNCGENAACTNTEGGYNCTCAGRPSSPGLSCPD
STAPSLLGEDGHHLDRNSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQT
RDLRWWELRHAGYGQKHDIMVVAVCMVALVLLLVLGMWGTYYYRTRKQLSNPPKNPCDEP
SGSVSSSGPNSSSGAAVASCPQPWFVVLEKHQDPKNGSLPADGTNGAVVDAGLSPSLQLG
SVHLTSWRQKPHIDGMGTGQSCWIPPSSDRGPQEIEGNSHLPSYRPVGPEKLHSLQSANG
SCHERAPDLPRQTEPVQ
NT seq 3654 nt   +upstreamnt  +downstreamnt
atgccctggggccgaaggccaacctggctgttgctcgccttcctgctggtgtttttaaag
attagcatactcagcgtcacagcatggcagaccgggaactgtcagccaggtcctctcgag
agaagcgagagaagcgggacttgtgccggtcctgcccccttcctagttttctcacaagga
aagagcatctctcggattgacccagatggaacaaatcaccagcaattggtggtggatgct
ggcatctcagcagacatggatattcattataaaaaagagagactctattgggtggatgta
gaaagacaagttttgctaagagttttccttaacgggacaggactagagaaagtgtgcaat
gtagagaggaaggtgtctgggctggccatagactggatagatgatgaagttctctgggta
gaccaacagaacggagtcatcaccgtaacagatatgacagggaaaaattcccgagttctt
ctaagttccttaaaacatccgtcaaatatagcagtggatccaatagagaggttgatgttt
tggtcttcagaggtgaccggcagccttcacagagcacacctcaaaggtgttgatgtaaaa
acactgctggagacagggggaatatcggtgctgactctggatgtcctggacaaacggctc
ttctgggttcaggacagtggcgaaggaagccacgcttacattcattcctgtgattatgag
ggtggctccgtccgtcttatcaggcatcaagcacggcacagtttgtcttcaatggccttt
tttggtgatcggatcttctactcagtgttgaaaagcaaggcgatttggatagccaacaaa
cacacggggaaggacacggtcaggattaacctccatccatcctttgtgacacctggaaaa
ctgatggtagtacaccctcgtgcacagcccaggacagaggacgctgctaaggatcctgac
cccgaacttctcaaacagaggggaagaccatgccgcttcggtctctgtgagcgagacccc
aagtcccactcgagcgcatgcgctgagggctacacgttaagccgagaccggaagtactgc
gaagatgtcaatgaatgtgccactcagaatcacggctgtactcttgggtgtgaaaacacc
cctggatcctatcactgcacatgccccacaggatttgttctgcttcctgatgggaaacaa
tgtcacgaacttgtttcctgcccaggcaacgtatcaaagtgcagtcatggctgtgtcctg
acatcagatggtccccggtgcatctgtcctgcaggttcagtgcttgggagagatgggaag
acttgcactggttgttcatcgcctgacaatggtggatgcagccagatctgtcttcctctc
aggccaggatcctgggaatgtgattgctttcctgggtatgacctacagtcagaccgaaag
agctgtgcagcttcaggaccacagccacttttactgtttgcaaattcccaggacatccga
cacatgcattttgatggaacagactacaaagttctgctcagccggcagatgggaatggtt
tttgccttggattatgaccctgtggaaagcaagatatattttgcacagacagccctgaag
tggatagagagggctaatatggatgggtcccagcgagaaagactgatcacagaaggagta
gatacgcttgaaggtcttgccctggactggattggccggagaatctactggacagacagt
gggaagtctgttgttggagggagcgatctgagcgggaagcatcatcgaataatcatccag
gagagaatctcgaggccgcgaggaatagctgtgcatccaagggccaggagactgttctgg
acggacgtagggatgtctccacggattgaaagcgcttcccttcaaggttccgaccgggtg
ctgatagccagctccaatctactggaacccagtggaatcacgattgactacttaacagac
actttgtactggtgtgacaccaagaggtctgtgattgaaatggccaatctggatggctcc
aaacgccgaagacttatccagaacgacgtaggtcaccccttctctctagccgtgtttgag
gatcacctgtgggtctcggattgggctatcccatcggtaataagggtgaacaagaggact
ggccaaaacagggtacgtcttcaaggcagcatgctgaagccctcgtcactggttgtggtc
catccattggcaaaaccaggtgcagatccctgcttatacaggaatggaggctgtgaacac
atctgccaagagagcctgggcacagctcggtgtttgtgtcgtgaaggttttgtgaaggcc
tgggatgggaaaatgtgtctccctcaggattatccaatcctgtcaggtgaaaatgctgat
cttagtaaagaggtgacatcactgagcaactccactcaggctgaagtaccagacgatgat
gggacagaatcttccacactagtggctgaaatcatggtgtcaggcatgaactatgaagat
gactgtggtcccggggggtgtggaagccatgctcgatgcgtttcagacggagagactgct
gagtgtcagtgtctgaaagggtttgccagggatggaaacctgtgttctgatatagatgag
tgtgtgctggctagatcggactgccccagcacctcgtccaggtgcatcaacactgaaggt
ggctacgtctgcagatgctcagaaggctacgaaggagacgggatctcctgtttcgatatt
gacgagtgccagcggggggcgcacaactgcggtgagaatgccgcctgcaccaacacggag
ggaggctacaactgcacctgcgcaggccgcccatcctcgcccggactgagttgccctgac
tctaccgcaccctctctccttggggaagatggccaccatttggaccgaaatagttatcca
ggatgcccatcctcatatgatggatactgcctcaatggtggcgtgtgcatgcatattgaa
tcactggacagctacacatgcaactgtgttattggctattctggggatcgatgccagact
cgagacctacgatggtgggaactgcgtcatgctggctacgggcagaagcatgacatcatg
gtggtggctgtctgcatggtggcactggtcctgctgctcgtcttggggatgtgggggact
tactactacaggactcggaagcagctatcaaaccccccaaagaacccttgtgatgagcca
agcggaagtgtgagcagcagcggacccaacagcagcagcggggcagctgtggcttcttgt
ccccaaccttggtttgtggtcctagagaaacaccaagaccccaagaatgggagtctgcct
gcggatggtacgaatggtgcagtagtagatgctggcctgtctccctccctgcagctcggg
tcagtgcatctgacttcatggagacagaagccccacatagatggaatgggcacagggcaa
agctgctggattccaccatcaagtgacagaggaccccaggaaatagagggaaactcccac
ctaccctcctacagacctgtggggccggagaagctgcattctctccagtcagctaatgga
tcgtgtcacgaaagggctccagacctgccacggcagacagagccagttcagtag

KEGG   Mus musculus (mouse): 18590
Entry
18590             CDS       T01002                                 

Gene name
Pdgfa, PDGF-1
Definition
(RefSeq) platelet derived growth factor, alpha
  KO
K04359  platelet-derived growth factor subunit A
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04540  Gap junction
mmu04630  JAK-STAT signaling pathway
mmu04810  Regulation of actin cytoskeleton
mmu05200  Pathways in cancer
mmu05202  Transcriptional misregulation in cancer
mmu05206  MicroRNAs in cancer
mmu05214  Glioma
mmu05215  Prostate cancer
mmu05218  Melanoma
mmu05231  Choline metabolism in cancer
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    18590 (Pdgfa)
   04014 Ras signaling pathway
    18590 (Pdgfa)
   04015 Rap1 signaling pathway
    18590 (Pdgfa)
   04630 JAK-STAT signaling pathway
    18590 (Pdgfa)
   04020 Calcium signaling pathway
    18590 (Pdgfa)
   04072 Phospholipase D signaling pathway
    18590 (Pdgfa)
   04151 PI3K-Akt signaling pathway
    18590 (Pdgfa)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    18590 (Pdgfa)
   04540 Gap junction
    18590 (Pdgfa)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    18590 (Pdgfa)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    18590 (Pdgfa)
   05202 Transcriptional misregulation in cancer
    18590 (Pdgfa)
   05206 MicroRNAs in cancer
    18590 (Pdgfa)
   05231 Choline metabolism in cancer
    18590 (Pdgfa)
  09162 Cancer: specific types
   05214 Glioma
    18590 (Pdgfa)
   05218 Melanoma
    18590 (Pdgfa)
   05215 Prostate cancer
    18590 (Pdgfa)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    18590 (Pdgfa)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    18590 (Pdgfa)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    18590 (Pdgfa)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    18590 (Pdgfa)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   18590 (Pdgfa)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   18590 (Pdgfa)
SSDB
Motif
Pfam: PDGF_N PDGF
Other DBs
NCBI-GeneID: 18590
NCBI-ProteinID: NP_032834
MGI: 97527
Ensembl: ENSMUSG00000025856
Vega: OTTMUSG00000025151
UniProt: P20033 Q99L56
Position
5 G2; 5 77.65 cM
AA seq 196 aa
MRTWACLLLLGCGYLAHALAEEAEIPRELIERLARSQIHSIRDLQRLLEIDSVGAEDALE
TSLRAHGSHAINHVPEKRPVPIRRKRSIEEAIPAVCKTRTVIYEIPRSQVDPTSANFLIW
PPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACA
TSNLNPDHREEETDVR
NT seq 591 nt   +upstreamnt  +downstreamnt
atgaggacctgggcttgcctgctgctcctcggctgcggatacctcgcccatgccctggcc
gaggaagccgagataccccgggagttgatcgagcggctggctcgaagtcagatccacagc
atccgggacctccagcgactcttggagatagactccgtaggggctgaggatgccttggag
acaagtctgagagcccatgggtcccatgccattaaccatgtgcccgagaagcggcctgtg
cccattcgcaggaagagaagtattgaggaagccattcctgcagtttgcaagaccaggacg
gtcatttacgagatacctcggagccaggtggaccccacatcggccaacttcctgatctgg
cccccatgtgtggaggtgaagcgctgcactggctgttgtaacaccagcagcgtcaagtgc
cagccttcacgggtccaccaccgcagtgtcaaggtggccaaagtggagtatgtcaggaag
aagccaaaattgaaagaggtccaggtgaggttagaggaacacctggagtgtgcatgtgcg
acctccaacctgaacccagaccatcgggaggaggagacagatgtgaggtga

KEGG   Mus musculus (mouse): 18591
Entry
18591             CDS       T01002                                 

Gene name
Pdgfb, PDGF-, PDGF-2, PDGF-B, Sis, c-sis
Definition
(RefSeq) platelet derived growth factor, B polypeptide
  KO
K17386  platelet-derived growth factor subunit B
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04540  Gap junction
mmu04630  JAK-STAT signaling pathway
mmu04810  Regulation of actin cytoskeleton
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05200  Pathways in cancer
mmu05206  MicroRNAs in cancer
mmu05211  Renal cell carcinoma
mmu05214  Glioma
mmu05215  Prostate cancer
mmu05218  Melanoma
mmu05231  Choline metabolism in cancer
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    18591 (Pdgfb)
   04014 Ras signaling pathway
    18591 (Pdgfb)
   04015 Rap1 signaling pathway
    18591 (Pdgfb)
   04630 JAK-STAT signaling pathway
    18591 (Pdgfb)
   04020 Calcium signaling pathway
    18591 (Pdgfb)
   04072 Phospholipase D signaling pathway
    18591 (Pdgfb)
   04151 PI3K-Akt signaling pathway
    18591 (Pdgfb)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    18591 (Pdgfb)
   04540 Gap junction
    18591 (Pdgfb)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    18591 (Pdgfb)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    18591 (Pdgfb)
   05206 MicroRNAs in cancer
    18591 (Pdgfb)
   05231 Choline metabolism in cancer
    18591 (Pdgfb)
  09162 Cancer: specific types
   05214 Glioma
    18591 (Pdgfb)
   05218 Melanoma
    18591 (Pdgfb)
   05211 Renal cell carcinoma
    18591 (Pdgfb)
   05215 Prostate cancer
    18591 (Pdgfb)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    18591 (Pdgfb)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    18591 (Pdgfb)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    18591 (Pdgfb)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    18591 (Pdgfb)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    18591 (Pdgfb)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   18591 (Pdgfb)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   18591 (Pdgfb)
SSDB
Motif
Pfam: PDGF PDGF_N
Other DBs
NCBI-GeneID: 18591
NCBI-ProteinID: NP_035187
MGI: 97528
Ensembl: ENSMUSG00000000489
UniProt: P31240 A0A0R4IZW4
Position
15 E1; 15 37.85 cM
AA seq 241 aa
MNRCWALFLPLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHRDSVDEDGAEL
DLNMTRAHSGVELESSSRGRRSLGSLAAAEPAVIAECKTRTEVFQISRNLIDRTNANFLV
WPPCVEVQRCSGCCNNRNVQCRASQVQMRPVQVRKIEIVRKKPIFKKATVTLEDHLACKC
ETVVTPRPVTRSPGTSREQRAKTPQARVTIRTVRIRRPPKGKHRKFKHTHDKAALKETLG
A
NT seq 726 nt   +upstreamnt  +downstreamnt
atgaatcgctgctgggcgctcttccttcctctctgctgctacctgcgtctggtcagcgcc
gagggggatcccattcctgaggaactgtatgaaatgctgagcgaccactccatccgctcc
tttgatgatcttcagcgcctgctgcacagagactccgtagatgaagatggggctgagctg
gacttgaacatgacccgagcacactccggagtcgagttggaaagctcatctcgagggagg
aggagcctagggtccctggcagcagcagagcctgctgtaatcgccgagtgcaagacgcgc
acagaggtgttccagatctctcggaacctcatcgatcgcaccaacgccaacttcctggtg
tggccgccctgtgtggaggtgcagcgctgctccggctgctgcaataaccgcaatgtgcaa
tgccgggcctcgcaggtgcagatgcggccggtccaggtgagaaagattgagattgtgcga
aagaagcccatcttcaagaaggccacagtgaccttggaggaccacctcgcctgcaagtgt
gagacagtagtgacccctcggcctgtgactagaagtcctgggacatccagggagcagcga
gccaagacgcctcaagctcgggtgaccattcggacggtgagaatccgccggccccccaaa
ggcaagcaccgaaagtttaagcacacccatgacaaggcggccctgaaggagaccctcgga
gcctag

DBGET integrated database retrieval system